Acyrthosiphon pisum

  • Attention, this profile may contain isoforms/alternatively spliced forms from NCBI protein database!
  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|193728555|ref|XP_001942792.1| PREDICTED: similar to methionine sulfoxide reductase A, partial [Acyrthosiphon pisum]
    ESTVVPFFDKSQTVDKASALPGRTTPMPVATLNVVTEHSMTQVPAGMEVAIFAMGCFWGVERLFWQQPGVYSTAAGYSGG
    YTPNPTYREVCSGQTGHAEVVRVVFDPQVVSYKQLLQVFWENHDPAQGMRQGGDVGTQYRSAIYTLSPEQQAEAESSLQR
    FQQAMAAAGDKRVITTEIAPALPFYYAEDDHQQYL

    >gi|193664658|ref|XP_001949463.1| PREDICTED: similar to mitochondrial thioredoxin 2 [Acyrthosiphon pisum]
    MSLPKIITRTFKTTATRHRIIKIQDQEDFNKHVLNSKEPVVIDFFATWCGPCKMLLPRVEKIIEEYKDTIHLAKVDIDDN
    AEIAMEYGVSVVPELVLMKDGKVQGKMIGLQDEDKLKHFISKLTEPTIEKK

    >gi|193590626|ref|XP_001951126.1| PREDICTED: similar to conserved hypothetical protein [Acyrthosiphon pisum]
    MSFNRFRCLEKVHQTTKRSMSVGRIYRKSFTVCGSEDFIQNVLKSDIPVIVNFHAEWCEPCLTLTPMLKKMVGDSPSVHL
    AIVDVEKNADLVHTFEVKAVPAVLAIRDGHVIDKFIGLIDNDMINEMVKKISKPEI

    >gi|193662069|ref|XP_001945389.1| PREDICTED: similar to lethal (1) G0136 CG8198-PA [Acyrthosiphon pisum]
    MAGRIVSASIRAVVGSKKPIKAALTLTPSAVDQLKKILSGKSNCIGLKIGVKQRGCNGLSYTLDYASEKHKLDEEVVQDG
    IRVFIDRKAQLTLLGTEMDFVQSKLSSEFVFYNPNIKGTCGCGESFNI

    >gi|193713655|ref|XP_001950406.1| PREDICTED: similar to AGAP007393-PB [Acyrthosiphon pisum]
    MKFMRGLIVFSGFLLSSVLADSVVDLSDSDFDSSVAEFDTSLVMFYAPWCGHCKKLKPEFEKAAKSLLKEDPPVTLAKVD
    CTEAGKEVCNKFGVSGYPTLKIFRNGEVSKEYNGPRDSAGIVKYMKSQVGPSSKDLSSEDIIKNFLSKDDVVVVGFFETE
    TDLKGKFVQLANKLREKVNFGHTTSQSVIDKYNYKNNVVLYRPKHLSNKFEPDFVVYDGEESTSALDSWITSNYHGLVGY
    RQKENMEAFKPPYVGVYYAVDYVKNPKGTNYWRNRVLKVAKSVKDVTFAVNNKDDFQHEINEYGLEFVSDDKPIVLARSL
    DNKKYIMKDEFSVENLEKFVNDFQDGNLEPYIKSESVPEDNTTPVKVAVAKNFDDLVINNGVDTLVEFYAPW
    CGHCKSLA
    PVYEQVAEKLKDEAVSLVKMDATANDVPSTFDVRGFPTLYWLPKDSKNKPIRYEGGRDVNDFIKYIASKATDELSGFDRS
    GNPKDGKHEL

    >gi|193659720|ref|XP_001943176.1| PREDICTED: similar to molybdopterin biosynthesis moeb protein [Acyrthosiphon pisum]
    MNNDEEISLLSAEIALLNKQCLTKLDINRYSRQIILPEIGVEGQKKLKTASVLIIGVGGLGCPSSMYLASAGVGTIGLVD
    YDEVELSNLHRQLLHAQCNVGMRKVESGKLSLNRMNEDVNIVVHDVQLDGHNSLDIFKQYDVIIDASDNLVTRYIINDTC
    VKAGKPLVSGSAIHCDGQLTVYNYKGSVCFRCLHPKPQSPETVGN
    CASVGVLGPVPGVIGVLQAMETIKIIVDHPNVLHN
    SLLLYDGVDCEFKKIKLTNVKRNGCICTKNPEDITITMDYEEFCGSKANDKVNLIYLNELISKKNPFLMIDVRKKVEYDM
    CHLPFSINIQLSDLKSKDTRSKLIEKINSFSNMTPNLITICRRGNDSQRAVDELKKYTEITDNVKWIKDVIGGLHEWSMQ
    VDENFPIY

    >gi|193706918|ref|XP_001952276.1| PREDICTED: similar to thioredoxin-dependent peroxidase (AGAP011824-PA) [Acyrthosiphon pisum]
    MRLGTVVPDFSAVTTKGPINFYEWVGESWCVLFSHPSDFTPVCTTELGKMAVLVDEFTKRSVKVLGLSCDKLESHVDWIN
    DIKSYCLDIKGEFPYPIISDSTRDLAVQLDMISEEDKDNVELALTIRSLYIIGPDKKVKLMMVYPTSTGRNIQEILRCID
    SLQLCDRKNTIATPANWVPGEKVMILPTVKDEDLDTLFPNGYEKRSMPSSVDYLRTTTDY

    >gi|193676612|ref|XP_001945231.1| PREDICTED: similar to glutaredoxin (AGAP011107-PA) isoform 3 [Acyrthosiphon pisum]
    MGSLSSRRIPSPTQVMAATQFVKDAIAHDPIVIFSKSDCGYCQMAKECFDKLKATYKSIDLDKREDMDDIQDALEGITGA
    RSVPRVFVNGVFIGGGSDVRKMSQNGKLEELLKK

    >gi|193676614|ref|XP_001945182.1| PREDICTED: similar to glutaredoxin (AGAP011107-PA) isoform 2 [Acyrthosiphon pisum]
    MGSLSSRRIPSPTQVMAATQFVKDAIAHDPIVIFSKSDCGYCQMAKECFDKLKATYKSIDLDKREDMDDIQDALEGITGA
    RSVPRVFVNGVFIGGGSDVRKMSQNGKLEELLKK

    >gi|193676616|ref|XP_001945281.1| PREDICTED: similar to glutaredoxin (AGAP011107-PA) isoform 4 [Acyrthosiphon pisum]
    MAATQFVKDAIAHDPIVIFSKSDCGYCQMAKECFDKLKATYKSIDLDKREDMDDIQDALEGITGARSVPRVFVNGVFIGG
    GSDVRKMSQNGKLEELLKK

    >gi|193584746|ref|XP_001943433.1| PREDICTED: similar to putative thioredoxin-like protein [Acyrthosiphon pisum]
    MVVKEIMSDTQFRDILNLNLTKLIVVDFYAIWCGPCKRVAPKYIELSNKYDRALFLEVDVDKCEETATSEGVSAMPTFIL
    YRNKLQVAKIRGADIATVESKIIELYEAPRVAAVEDCGVPGQMDLSSFIVRSQCEALNDSDDHPLPGLFEKSGYIESDCD
    QQLILSFIFTKPVKVHSIKVKAPKHNGPKSLRLFTNHPNTIDFDSATFNLAAQELDLKPDDLDGKIVNLKYVKFQNVYNL
    QIFVVNNQTEEEVTRIDSLNIIGMPTSVTLMGDFKRIAGKVGESH

    >gi|193676618|ref|XP_001945131.1| PREDICTED: similar to glutaredoxin (AGAP011107-PA) isoform 1 [Acyrthosiphon pisum]
    MAATQFVKDAIAHDPIVIFSKSDCGYCQMAKECFDKLKATYKSIDLDKREDMDDIQDALEGITGARSVPRVFVNGVFIGG
    GSDVRKMSQNGKLEELLKK

    >gi|193676620|ref|XP_001945336.1| PREDICTED: similar to glutaredoxin (AGAP011107-PA) isoform 5 [Acyrthosiphon pisum]
    MAATQFVKDAIAHDPIVIFSKSDCGYCQMAKECFDKLKATYKSIDLDKREDMDDIQDALEGITGARSVPRVFVNGVFIGG
    GSDVRKMSQNGKLEELLKK

    >gi|193643545|ref|XP_001948247.1| PREDICTED: similar to CG7430 CG7430-PA [Acyrthosiphon pisum]
    MAVKPNMLQKSKHIECGFIYSVVNRRYASGDSVDLVVIGSGPGGYVAAIKAAQLGLNTVCVEKNPTLGGTCLNVGCIPSK
    ALLNNSHYYHMAHSGDLKSRGIEVENVKLNLEVLMQTKTNAVTALTGGIAHLFKSNKITLAKGHGKIKDPNTVSVLKEDG
    SSEDIKTKNILIATGSEVTPFPGIDIDEETVVSSTGALKLSKVPEKMIVIGAGVIGLELGSVWSRLGAKVTAVEFMPTIG
    GVGIDGEVSKQFQKILTKQGLGFKLGTKVISASKSGGQILVEVENAKDSSKKETLDCDVLLVSVGRRPYTQNLGLEENSI
    EKDAKGRIPVNSRFQTVIPNIFAIGDCIHGPMLAHKAEDEGIVCVEGITGAPVHIDYNCVPSVIYTHPEVAWVGKSEEDL
    KNEGVDYKVGKFPFAANSRAKTNNETDGFIKVLGDKVTDKLLGCHLIGPGVGEIVNEAVLAMEYGASCEDIARVCHAHPT
    CSEALREANLAAYFGKAINFG

    >gi|193728559|ref|XP_001942899.1| PREDICTED: similar to methionine sulfoxide reductase A, partial [Acyrthosiphon pisum]
    ESTVVPFFDKSQTVDKASALPGRTTPMPVATLNVVTEHSMTQVPAGMEVAIFAMGCFWGVERLFWQQPGVYSTAAGYSGG
    YTPNPTYREVCSGQTGHAEVVRVVFDPQVVSYKQLLQVFWENHDPAQGMRQGGDVGTQYRSAIYALSPEQQAEAESSLQR
    FQQAMDAAGDKRVITTEIAPALPFYYAEDDHQQYLFKNP

    >gi|193606219|ref|XP_001951050.1| PREDICTED: similar to venom protein 5 [Acyrthosiphon pisum]
    MIASTAFSVVFLLVIVTKTSSMDLATTKKVLAKPLYDAPRVDNQNSVPKLTVSIYYGSLCSDSVDLFKNQIGPNLAKFQK
    YVNFDFLPFGKSDKKLFEGRWFFKCQKGLTECMKNKWQACSIHVLPSKLQLLANYLVCYMSSKVETHSGYQCTRNMGLYD
    DYYGKIKKCFMNRELSDSLMVQYSNRTQTVLPQSAQIPSIVINGVYNEMEQDEAKNNLRNVICKYIHPKPVGLC

    >gi|193700159|ref|XP_001948417.1| PREDICTED: similar to CG7217 CG7217-PB isoform 2 [Acyrthosiphon pisum]
    MFCSIGALQKTVCAVPSTVLSTITKRLLSISLNSKMPVKVGDTIPSIDLFENTPNTKVNISELCSGKTVILFAVPGAFTP
    G
    CSKTHLPGYVNTADDLKSKGVDEIVCVSVNDAFVMAAWAQDQKAEGKVRLLADPNAELTNAFDLAINLPPLGGTRSKRY
    SMLIKDGKVEQLNVEPDNTGLSCSLANKIVL

    >gi|193700161|ref|XP_001948371.1| PREDICTED: similar to CG7217 CG7217-PB isoform 1 [Acyrthosiphon pisum]
    MPVKVGDTIPSIDLFENTPNTKVNISELCSGKTVILFAVPGAFTPGCSKTHLPGYVNTADDLKSKGVDEIVCVSVNDAFV
    MAAWAQDQKAEGKVRLLADPNAELTNAFDLAINLPPLGGTRSKRYSMLIKDGKVEQLNVEPDNTGLSCSLANKIVL

    >gi|193695142|ref|XP_001947162.1| PREDICTED: similar to CG7484 CG7484-PB [Acyrthosiphon pisum]
    MQKKLLIIPLLMLFGNRCNGDYTTNECSLLGFNKANLLCSSCDQLKKFQLTSLREHCTNCCQIDEEKSIKVYAKARLEVC
    T
    CKFGAYPQIQAFIKSDRPNKYPNLTIRYVRGLDPLIKLMDSSGNVQEVLAIERWDTDTVDEFLSTHLERIEDDYRSNLV


    >gi|193716283|ref|XP_001947115.1| PREDICTED: similar to SelR CG6584-PE [Acyrthosiphon pisum]
    MSQGESADFKADLKKRLSPIQYHVTQEKGTERAFTGKFNKTTEAGLYTCVVCNETLFTSETKFDSGCGWPAFNDVIDQKK
    VKLTTDTSNVGANLLLLITNPGMIRTEVQCGKCDAHLGHVFKDGPPPTGRRF
    CINSASMNFHPINQEK

    >gi|193669302|ref|XP_001943507.1| PREDICTED: similar to ubiquitin-activating enzyme E1 [Acyrthosiphon pisum]
    MSGAEVLDTTCELPAKKRKLASGEPSTVSVDSAPRNQVTMSNNGVEEIDEGLYSRQLYVLGHEAMRKMATSDVLISGLGG
    LGVEVAKNVILGGVKSVTLHDSVVCTYSDLSSQFYLTENDIGKNRADISCPKLGELNSYVPVKSYTGILSESYLKQFKVV
    VLTETTLDEQLRISEITHQNNIALIVGDTRGVFAQVFCDFGEDFSVIDSTGENPISVMVAGVTKEEQGVVTCMDESRHGF
    EDGDYVTFQEVQGMTEINGCKPKKITVLGPYTFSIGDTTSYSDYIKGGFATQVKMPKKLNFKSLKNSLAEPEYLISDFGK
    FDRPSQLHLAFITFHKFVSVNGRLPIPWSSDDANEFLKLTKSVNNDDSIELDVDLIKIFSKVCAGNINPMTSFIGGIVAQ
    EVMKSCSGKFSPIFQWLYFDATESLPDEVTEEDAKPIGNRYDGQVSIYGRKFQSILGDLKYFVVGAGAIGCELLKNFAIM
    GVGCGNGKIYVTDMDLIEKSNLNRQFLFRAQDVQTSKSETAAKAIKRMNPNINVEPQTNRVCPETEQTYNDTFFENLDGV
    ANALDNVDARIYMDRRCVFYKKPLLESGTLGTKGNTQVVIPNLTESYSTSQDPPEKSIPI
    CTLKNFPNAIEHTLQWARDL
    FEGLYKQTPENVKQFLEDPTFIDRTNRLPGLQPVEILDSVRTSVAERPQSVDDCIEWARMHFEDQFTNQIKQLLFNFPPD
    QSTTSGQPFWSGPKRCPKPIIFDVNNTLHLDYILTAANLRAETYNINQVRDRVYIANVVSSVKVPEFVPKSGVRIAENDS
    QITNGSSNYDQSKLNKTQKDLPPTDSLKNIKIVPLEFEKDDDSNLHIDFIVAASNLRATNYGIQPADRHRSKLIAGKIIP
    AIATTTSVVAGLVCQEFIKLARGLKDLEKYKNGFVNLALPFFGFSEPLLAPKSKYYDVEWTLWDRFEVEGELTLNEFLNY
    FKDKHALEITMLSQGVCMLYSFFMPKAKREERINTKMSEIVRNISKKRIEPHVKSLVFEICCNNTDGEDVEVPYVKYNLP
    SDFQY

    >gi|193580161|ref|XP_001946637.1| PREDICTED: similar to putative peroxiredoxin [Acyrthosiphon pisum]
    MSNNQQHEEYTILTTGSNNRGQMSQPHLTFTPPTQVFRSEWQRFPEFHAWLRPIDGDVTKAWCIACERMFRADLKSLRVH
    GVSKAHVRMVRARCPNADDNPIPPIEYNVVTDKKGTYGIAVVTNKEDKSSLGSRALYMNQTNPTEEIITSEMAAQSQRDK
    YVVVSLPNEDDDDNEGPQASSSNTQYIQKEVNVIDETGNLVSVVTEHHQYLSCKIKLIKFLRKRDIQVESEIKSGIAEAQ
    KQSADEDDIAIEEVLTPLRIKQESAANRAHMMKRKRGLQKYRTDWEKLSEFKGWLSPEPKSCYKARCEACDKSLVADITV
    LRNHSQAKKHVMKTGGTVYEGPIVRSKSKPKTDDDDDEDSPDDLQMKSLSIKGLNIGSRI
    CPSELIALSDRVSEFRALNT
    EVVACSVDSYLSHQAWSRTLRSDGGIAIPKMPLLSDPTHVISKSYGCYLSELGHSLRAHYIIDMRGILRHVTINDLPVGR
    NISEILRLLEAFQYTDETETLCPADWKPGEPTIS

    >gi|193695172|ref|XP_001948267.1| PREDICTED: similar to protein disulfide-isomerase A6 [Acyrthosiphon pisum]
    MNPLCYVLLAALANSAVAIYPSNSDVIELTDDNFNQVLQSVEIWVVEFYAPWCGHCQRLVPEYSKAAKALKGIVKVAAID
    ADKYPSFAXANLQGVPYGSSKSSKKSSSGDDVVELTDSNFDKLVLNSDDIWLVEFFAPW
    CGHCKNLAPHWAAAASELKGK
    VKLGALDATVHSSKAQEFNIRGYPTIKFFPSGTSSSSGAEEYTGGRTSSDIVSWAMQKHQENVPPPDIIEIVNEDTFKAG
    CSEHALCVVSVLPHILDCQASCRNEYLNTLRSLGDKFKQKLWGWLWAEAGKQPELESTLEIGGFGYPALAVLNVKKMKYS
    ILRGSFSEDGIKEFLRDLSYGRGTTAPVKGAALPEIQATEPWDGKDGELPTADDIDLSDVDLDDLPKEEL

    >gi|193577768|ref|XP_001944227.1| PREDICTED: similar to NHL repeat containing 2, partial [Acyrthosiphon pisum]
    MDRIIEISSVFVDLFNSSAGNQASTDESDLSIPVQLQEITEDYIQKILTACCSQQAAGIPGFQSGSVVGSSGLRVNEFKP
    NLDWFNCTKPLLFNKDLKGKLVLLDFFTYC
    CVNCLHILPVLHSLQQRFTCEDGLVIIGVHSAKFPNEQQSVNVHHAIEKY
    SIEHCVVNDTDGTMWNDLAVCCWPTLVLIGPNGEPMLVVQGEEFHSQLLPTFIETALQILRQASMISSHNIPEIVPGRTT
    LQSLATSKQSSVTKQHLLYPGKVFAYTKKLKKRKNNGNETLNSSNLNNRHHGKILVAIADSGHHRIVISTIQGRVKHVIG
    GGGTGLFSSTTKKGFKDGNFTEALFHSPQGICFQNSHILFVCDTENHAIRMIDLKEKTVKTVAGNGKKGHDKYGGQMWNA
    QILNTPWDVVYYKRKARPQYQQQYTPQPYTPNQNYQQLQQSTTSGPTPSPVRCLLIAMAGLHQIWALYLDKTSTSTCSSM
    KSKWCSKGLCTMVAGTGKEENRNNSYNGQRASFAQPSGLCLTKPSSRIGSVSNGCDPSLYIADSESSSVRRMYLDSMGKY
    RVLNVAGGSPDPTDLFSYGDIDGGAGANSRLQHPMDVAWNHKRNILYVADSYNHKIKYVTGLSDSHKQNHYNNGGGNTTT
    GGIPGSTGGSVHTLPLPVKLNEPNGLHFIENPQDGSSLLLIADTNNHSVWVYNFDTYVIKKLQLEFPKILESSPSNVVGT
    AQIRLNRRTGGQLMLRGRVILGSSSGTEVSQTLEDQPHLNWTLQLPDSTWESKEIKSNTSISAVVGAAADFKYLIRIPKQ
    EWEEDKNDENADDITSRDGNKRWNDKYNQDFENESDEDSEDESDDEEEIVILRCQTSVCQDDDKCVPVEFDFVVRVRYGD
    EENTPQAADTYFPYTLPYNKSGNKLLNRASSEINSHAPTYNVDSPMELVQSYENLKTDKTILKTRKLYTETFDDNDKDLN
    KERTVDSNLNKGEWTRRIPIASASEGDPFIAAGCRFKKKKKKKKGDQQMVQHFEDSTNDKGTMVVDKIYDETLHDYKHLN
    KNKPRDSNLNEDELTKSIPIASAPEGYSFIAAGCTFKKKKKKKKGDQQMVQHFEDSTNDKGTMVVDKIYDETLHDYKHLN
    KNKPRDSNLNEDELTKSIPIASAPEGYSLFKKKKKKKKGDQQKVQHFEDSTNDKGTMVVDKIYDETLHDYKHLNKNKPRD
    SNLNEDELTKSIPIASAPEGYSLFKKKKKKKKGDQQKVQHFEDSTNEKGTMIVDKIYDETLHDYKHLNKSKPRDSNLNKD
    KLTKSIPIASAPEGYS

    >gi|193697661|ref|XP_001949571.1| PREDICTED: similar to peroxiredoxins, prx-1, prx-2, prx-3 [Acyrthosiphon pisum]
    MITKLILVYLAMNTVDISNADEFKCKKFANGSVYPSSTIESTNHKLQYTKALISKPAPDWKGTAVINGSLQELKLKDFRG
    KYLVFFFYPLDFTFV
    CPTEILAFNDRIEEFRRIDANVVAASVDSHFTHLAWVNTPRKDGGLGNLSIPLLSDMTHKISKDY
    GVYLSDVGHSLRGLFIIDNRGILRQITMNDLPVGRSVDETLRLVQAFQYTDMHGEVCPANWKPGEQTIIPDPIKKKEYFD
    RLIEL

    >gi|193652680|ref|XP_001949032.1| PREDICTED: similar to CG6000 CG6000-PA [Acyrthosiphon pisum]
    MSVYENVDYDCLLAKMDRKSFVIDVRECHELAATGSLPNSINIPLGELENDLNLPTDVFKEKYKVPKPDKENDEIVFSCA
    RGNRSRRAAEIAFKLDYKKLYNYTGGWIEWSVKYPST

    >gi|193704456|ref|XP_001952649.1| PREDICTED: similar to predicted protein [Acyrthosiphon pisum]
    MEKIKNRLAQERSPYLLQHAENPVQWYPWGDEAFEKARSEKKLIFLSVGYSTCHWCHVMEHESFENRDVAAVMNEHYVNI
    KVDREERPDVDQLYMTFVQAASGQGGWPMSVFLTPDLKPIGGGTYYPPEDAYGRPGFKTILLHMAKRWKSDSKSMLENSS
    KMMKILNDTTAFDIQLGTELSNIMKPNPKTWITCYSQLQRIYDDEWGGFGMPPKFPQPTILDFLFHISHKMSKSYEGKKS
    LEMALETLQKMTMGGIHDHIGQGFARYSTDEKWHVPHFEKMLYDQAQLAVSYTTAFQITKHEQYSDVVHDILQYVSRDLS
    HKLGGFYSAEDADSLPTVDSTKKREGAFCTWTQEEVKTLLDQPLDSNPDIKLSELFCWHFSVLPNGNVRPDSDPHGELLG
    QNVLIEFRSKENTAKKFQITVENVEKELKIAKSILFEARKKRPRPHLDNKIITSWNGLMITAYARAASALNVEEYKQRAI
    KAAEFLKTHAWNNSVLLRSCYVNDIGDIANIEKPIAGFLNDYAFLIRGLLDLYECTLQSKWLKWADELQEQQNELFWDKE
    KFGYYSSSDKDPSIILRFKSDHDGAEPSGNSISALNLLRLSILTEKSEYRSKIDPLFLAFAGRLSGSSSALPALVSALTL
    HCDSITSVYVTGDLDNPELEALLSAIRQRYMPNLVLAHADENSLSELAKGLGIAENGKVAAYVCKNNTCNLPVHSTEELI
    ALLDGRVESPASN

    >gi|193636621|ref|XP_001947195.1| PREDICTED: similar to nucleoredoxin [Acyrthosiphon pisum]
    MAVELCLSSRLTELLGDRLLYGSATVELNESTFNGSLIALYFVPLGSETVTTDDRALRDLYKTVNENEKTLNIIQICYPD
    LADDRKYFDELTNDVPWHSVLYEYAEKRIRLRHKYRVGNAETLLILNDSYLEKVHTRNGLKLLSCREKSFPWTNLWNEKI
    CQEALKLSSNESNETIYGLYFSAHW
    CPPCKAFIPQLIHAYDSIRKRIQFEIIFVSSDRSEQSYNSHASSMPWPSVPYSNT
    TLRQDLTECFNVLGIPYLVLIDNNGNIITENGRAEITEDPDGVYFPWRRRFVYSLSSRLLPKLQSYPAVVLFIEGDQEEE
    LELAEGVLLPVAQQVAKTRSNALYDLLFFIAPDDCTSDTLRQFTRLTDDTAPLLTLIDIPMARISVMEYGIHITEKSIMN
    FVLGFFDGTMKFTPIL

    >gi|193713795|ref|XP_001951388.1| PREDICTED: similar to glutaredoxin 3 [Acyrthosiphon pisum]
    MVTSITSETEFDALKSNGLSVIHFYADWSEPCQHMNNILEDLVLEDEFRNIKIAKCLAEDFAEISLKYNVSAVPKFILFR
    NGVQVDVLDGADPIQLNKKIQALLTKGEKTDQKVEDISLRLKSLINSAPVMLFMKGSKSEPK
    CKFSTAIVNLLKEIGAEF
    STFDILKDQVVREKLKTYSNWPTYPQLYINGELIGGLDIVKELIENGELNDLLKLDNSKANLNDRLKSLTHKSDVMAFIK
    GNKQVAR
    CGFSNQLIQILNQTGIDYETFDILSDEEVRQGLKVYSDWPTYPQVYVKGSLIGGLDIIKELKEGGELIATLKG
    EI

    >gi|193645813|ref|XP_001942650.1| PREDICTED: similar to thioredoxin reductase [Acyrthosiphon pisum]
    MAPVEPSGQYDFDLLVIGGGSGGLACAKEASSFGKQVVVLDFVIPSEKGTTWGIGGTCVNVGCIPKKLMHQASLLGESIQ
    EARSYGWNIPDPISFNWESLVEAVQNHIKSVNWVTRVQLRDKKIEYVNGHGVFEDAHTVIAKMKNGKERRITAKDIVIAV
    GGRPRYPDFPGCKEY
    CITSDDLFSMPTSPGNTLVIGAGYIGLECAGFLKGLGYEATVMVRSMLLRGFDRGMVDLVQAEME
    HKGVNFLFGKIPVKVSKQPNGKLLVEWKGGDEVSSAWEFDTVLVATGRKALSEELNPSAAGLQVHPESFKFITNAEQTNI
    PNIYAVGDVLHERPELTPVAIQAGKLLAGRLYNGIQEQMDYDNVATTVFSPLEYGCVGLTEEEAINRYTENGIEVYHAYY
    KPTEFFIPQKNVKHCYLKVITLLEAPQKVLGMHFIGPQAGEVIQGYAAAIKAGLTYQHLKDTVGIHPTVSEEFTRVAITK
    RSGDDPTPQSC
    CS

    >gi|193709258|ref|XP_001949773.1| PREDICTED: similar to thioredoxin-like protein [Acyrthosiphon pisum]
    MVQLVTDAADLATKLTDAKEKLVIIDFFAKWCGPCKLMAPFIEELANEYPDVVMLKVDVDECEEAAIEYNIQSMPTFVFL
    KSKKEVVRFSGANKDKLKDNLLKHK

    >gi|193591797|ref|XP_001951959.1| PREDICTED: similar to SelT-like protein [Acyrthosiphon pisum]
    MAAFSTAFAVTVCCFALFGSTFVSSDGGGGAGNPSKSVHLGGKGPVEGQQTLKFLYCYSCGYQKAYDQYSSILSEKYPNL
    HIDGANYDPSMAHLLAAKVLSLAKMVIIIAIGSGINLFEYIGKQQPNWWIWCTSNKIYACLVVFFGSNMFEGMLISTGAF
    ELYLNDIPVWSKLETGRIPQPAELLQIIDNYLLFDNPYPA

    >gi|193666797|ref|XP_001949235.1| PREDICTED: similar to prostaglandin E synthase 2 [Acyrthosiphon pisum]
    MALRVAVARLKTVTGGPSLLRINNTFSRLKHFNSESPLAKHAKKRTSTVRLIGGGVAIGIVVGAAYSYFSYSERKLPGAI
    VNTPTQIPILKTLPTDLKVTRKVRHNNDETANFILFQYPT
    CPFCCKVRAFLDYVKVPYDIIEVDPILKQQISWSDYKKVP
    ILLVKSSNGYQPLTDSTMIVSALASYLKDKTFTIEDIANFYPSISYVDVDGKRKTDIMNKYFIMNEDESEKSKRLNFENE
    RQWRKWSDDTLVHALSPNAYRTLSEAIDSFKWFSIAGEWEKNFPFWETSLMIYGGAFMMWLISKKLKKKYMLKDDVRQSL
    YEECNTWVKAVEKNGGTFMGGNKPNLADLAVYGTLSSIEGCMAFKDIQENTKINVWFSNMKNVI

    >gi|193690452|ref|XP_001952474.1| PREDICTED: similar to CG7830 CG7830-PA, partial [Acyrthosiphon pisum]
    SLDQKVQQLNDLYQKKFLVKFNGPKFKEFVKSPPRNYSVIMMFTAMASHRQCSICGHASDEFIIVANSYRYSHRLTESPL
    YFGIVDFDEGSDIFQMLRINTAPVFMHFPAKGKPKPLDTMDIQRVGFASEMIAKWIQERTDVQIRIFRPPNYSSTLALSI
    LFAICSSFLYIRRNNMEMFFNKNLWGVFSVLFCLNMISGQMWNHIRGPPLMHRNQQGIITYIHNSSQGQFIVETYIIIIL
    NTILVFGAVIMIDSYTKKTDSKTRKIMTVGGLALVVFLFSVILSIFKSKAHGYPYSFLIK

    >gi|193613068|ref|XP_001946191.1| PREDICTED: similar to AGAP012395-PA isoform 1 [Acyrthosiphon pisum]
    MEPLHYLDIPSEKATFSMGCFWAPDSLFGSTPGIITTRVGYAGGTEGLIPTYRNIGDYTEAIQLQYDPNTVSYLELLKMF
    WDHHDPTAKFKKQYSSFIYYHNDQQKAEAELTLNEKKAKGLDVLTKIEPAGQFFNAEDYHQKYRLQQHKNLCKDLGLKTG
    DDLINSHVAARLNGYVVGQGGIDQFDSEVSKLRLDEAAISYIRQLVIKYEGQGLHC

    >gi|193613070|ref|XP_001946249.1| PREDICTED: similar to AGAP012395-PA isoform 2 [Acyrthosiphon pisum]
    MEPLHYLDIPSEKATFSMGCFWAPDSLFGSTPGIITTRVGYAGGTEGLIPTYRNIGDYTEAIQLQYDPNTVSYLELLKMF
    WDHHDPTAKFKKQYSSFIYYHNDQQKAEAELTLNEKKAKGLDVLTKIEPAGQFFNAEDYHQKYRLQQHKNLCKDLGLKTG
    DDLINSHVAARLNGYVVGQGGIDQFDSEVSKLRLDEAAISYIRQLVIKYEGQGLHC

    >gi|193617633|ref|XP_001951874.1| PREDICTED: similar to Quiescin-sulfhydryl oxidase4, putative [Acyrthosiphon pisum]
    MLIWCSGHAVIVLLVAALSTAPAYTELIGLYEESDLLEILDSTNFNDKVLQGNTSYVIEFYNAFCGHCIRFSTPWKGFGI
    QVYGWRNYVKVGVIDCSNEINSQTCRDYEVMAYPTVRYFPPRPASSNIGIEFTRSFNIQVMKDFLIKMLQETQSSTNVST
    LCDIQPFENVIVEMDSNNILTFIIISTPNNKIAQELIIDFCPVKKVKIISVLNSNTGLAELLKTETYPSLYLVEDNNQFT
    LLASGNNKTNFTNTINTYLETVHMTPFSLFDITTTLYNLLFHKDKGSMHNDNTVYLSDLEATLRYSLEHEILSRSVISGE
    SLNALNSYLELLIECFPSSIRGKKFIKLIWENTHLNKTVSGEKLGNLINNYEFLLKPYVTKHSWIGCEGSQPMYRKYPCG
    LWTTFHTLSVQASIKNLTTFNGRQVLQTIAGYVKYFFG
    CTDCSEHFMNMATTIQTNVSSLDDAVLWLWSAHNQVNQRLTG
    DVTEDPMHPKILFPLKVYCETCHQNGTDEWNKTEVLKYLKNMYSAISLQKTPYDNIDSKYDNLIIPSKRSIDDNSNYNNN
    VFDEEEWKIDVSTYMSFTDRACHGPFHYTNTGTLSPQMKLLIAVVDPAWA

    >gi|193629570|ref|XP_001942918.1| PREDICTED: similar to AGAP002816-PA, partial [Acyrthosiphon pisum]
    LKGNIDETNSTVEIVDKFNNYQIYPRIISIVSKDYFKFFKVNLRRTCPFWSDDSKCAMRYCQVESCQLDDLPIGLKGSRH
    SLVDEDMSIKYMEGPQQQECEEAMQDELGYINTTISAAAMEDFALWQAHDDIQDMYCTLPDDDGEAEYVDLSLNPERYTG
    YKGPSANRVWNTIYMENCFRPKNLFEVYIISAKLTGMCLEKRAFYRAISGLHTSINIHLSAQYLLSGPCGTGFWGPNAEE
    FERKFGPKYTRGEGTQWLRNLYFLYLVELRALQKAAPLLKQVEYYTGNDKEDEATRLAVHNFLGIIKKFPQQFNEHTMFL
    GGQQAQKLKEEFRLHFRNVSTIMDCVGCDKCRLWGKLQVQGLGTALKILFSNKARMNGYNELSTTVNKHTLQLERSEIVA
    LFNAFGSNVIKNRSPIRPVKYLPLSNKNKFEIGPIYEL

    >gi|193641143|ref|XP_001944316.1| PREDICTED: similar to AGAP002500-PA [Acyrthosiphon pisum]
    MTSLLRQMCNINKTTRISSLNIYKQFLCTKSDDPIQSHIGKLVKGNKIVVFMKGNPQAPRCGFSNAVVDILNIHKAKFEA
    HDVLVDENLRNGIKEFSNWPTIPQVFVDGEFIGGCDILLQLHRSGELDKILEKNNQEKPVA

    >gi|193664502|ref|XP_001945069.1| PREDICTED: similar to GA21779-PA [Acyrthosiphon pisum]
    MKCLMFVVAVAAFAAVSADRIKRAPLKVSVYYESHCPDSRDFIISQLHPYFCKVQQYLNLNLVAFGKAYSSDQGFTCQHG
    PKECRGNTIHNCVLKRIQDSKAQVDYVNCAMYDPDQPGHIEKTCVEESGLNVDQVQKCFSSSEGYEMMLKAEIETKTMTP
    GPLFVPTIVFDDVYNENDQNQAFVNFESTLCEKLISHGHTNVCSNGVIRNTQTC

    >gi|193709296|ref|XP_001951494.1| PREDICTED: similar to AGAP000909-PA [Acyrthosiphon pisum]
    MNQNYWKIFANKLFLLFFSSAYLFYNPVTGNAVKLNSQNVDMTLASNELVIINFYADWCRFSGILTPIFEEAAAKVSELY
    PESGKVVLGKVDCDTETSIASRFQITKYPTIKVLINGQPAKREYRGKRSVEAFVSFVQKQLEDPIQEVSSLFAKADVKSR
    VVIGYFENKDSQEYQVFRKVATNLKDDCLFYAGVGETFRAMHPPNETIIEFRPDRASPKSEHHTFRGNSADYDSLNIWAT
    DNCLPLVREITFENAEEITEEGLPFLLFFYHPDDLESIKLFKEIVGTYLIQEKQRVNFLTADGVKFAHPLQHLGKRHTDL
    PVVVIDSFKHMYQFPEKSDYKNHEHLKTFIDDLYSGKLHREYHLGPQEISAIEVIHGHNQPAEQTMPPESTFKKLAPSKN
    RYTLLKEEL

    >gi|193650191|ref|XP_001949493.1| PREDICTED: similar to CG5554 CG5554-PA [Acyrthosiphon pisum]
    MSKPLCAILLVAIGSLCLLAADANVVDAGNGDHHSLELDENNWTNVLTDEWMVLFYAPWCPACKSLEPEWREFAKWSESH
    SSVSVASTDITISPGLTGRFIVTTLPTIFHVKNGVFRYYKMGRDKDSMVSFIKERKWEQIESISSWKSPNSIQMSLVAQF
    FKLSQKVRILHSTLMAEYGLPTWGSYLIFAIATIFIGAILGLVLVCIIDLVYPPSHHKMPVKDGKDENSDSGQESDDDDE
    LVKDELLDDQASDEPTENEPLLRNRRKIRKTD

    >gi|193673954|ref|XP_001951821.1| PREDICTED: similar to putative thioredoxin-like protein [Acyrthosiphon pisum]
    MVVKEIMNDSQFQEELNANGMKLVVVDFSATWCGPCKRVAPLYDQLSNKYDRAVFLKVDVDKCQETAASQGVSAMPTFIL
    YRNKVKVAKIQGADIAAVESKIVQLYEAACAASGEDCGVPGQMDLNSFIMKTQCEALNDSDDHPLSALIENSGYIESDCD
    QQLILSLTFTQSVKVHSIKIKAPKDNGPKSLKLFINQPNTIDFDAATCNLATQELELKPDELDGKIVNLKYVKFQNVHNL
    QIFVVNNQTDEEVTRIDSLDIIGMPISTTNMGDFKRVAGKVGEAH

    >gi|193656973|ref|XP_001950073.1| PREDICTED: similar to disulfide isomerase [Acyrthosiphon pisum]
    MILHVAFAAFLLVNSAIADAGVQEQVAVESDEGVLVLTKDNFQSIVSSSEYLLVKFYAPWCGHCKQLAPEYANAAQHLAQ
    NELSVKLGKVDATIESDLAEQFGIRGYPTLKFFKNGKPIDYSGGRTKDEIIQWVLKKSGPAAKVLQSEEEVQSFIEGKHV
    AIVGYFENLESDAAKLFSELADSVDDHPFGLVSDYSKFSNLEHKDTFVLYKDFDEKKVPYDKDIANVEDIKTFIFVHSLP
    PIIEFNQDTAQKIFGGQIKSHLLLFLSKKEGHFEKFIDDIKPVALDFRGKIVFVTINADEEEHQRILEFFGMKKNEVPSM
    RAIKLEDDMTKFKPESPDLTGENVRKFVSDFVEGKVKQHLLSEELPEDWNKTPVWTLTATNFDSVALDSTKNVLVEFYAP
    W
    CGHCKQLAPIFDKVGEHFADKDDIVIAKMDATVNELEHTKISSFPTLTYYPKGDSPKAIEYNGDRTLEAIIKFIEADGK
    QESSSSTTSEEGDEEEEEVEREKPKDEL

    >gi|193713864|ref|XP_001949123.1| PREDICTED: similar to augmenter of liver regeneration [Acyrthosiphon pisum]
    MSIFNNIYNSFLVFINSHQRSPLKIYNVNEKPVENIIAQHSQADVPCRSCTDFRTFSRMRRQEFSQSQVHSLNSQSKDNN
    DETKILEHQGDDCPLDKNELGRSTWKLLHTIAATYSDEPSHEDQSNMEQFIRLIPKVYP
    CEVCANDFSEILTYHPPNISS
    QKSFAKWMCEVHNMVNRKLEKPLFDCSKVNERWRDGWADGHCE

    >gi|193664543|ref|XP_001945790.1| PREDICTED: similar to CG7830 CG7830-PA, partial [Acyrthosiphon pisum]
    SLDQKVQQLNDLYQKKFLVKFNGPKFKEFVKSPPRNYSVIMMFTAMASHRQCSICGHASDEFIIVANSYRYSHRLTESPL
    YFGIVDFDEGSDIFQMLRINTAPVFMHFPAKGKPKPLDTMDIQRVGFASEMIAKWIQERTDVQIRIFRPPNYSSTLALSI
    LFAICSSFLYIRRNNMEMFFNKNLWGVFSVLFCLNMISGQMWNHIRGPPLMHRNQQGIITYIHNSSQGQFIVETYIIIIL
    NTILVFGAVIMIDSYTKKTDSKTRKIMTVGGLALVVFLFSVILSIFKSKAHGYPYSFLIK

    >gi|193599000|ref|XP_001947714.1| PREDICTED: similar to ubiquitin-activating enzyme E1 [Acyrthosiphon pisum]
    MAATIAGVFNPELQNLIKESKVLLVGAGGIGCEVLKNLVLTGFSELEVIDLDTIEVSNLNRQFLFNKESVGKAKSHVAKT
    SVLKFNPNVNIMSHFGDIMDTKYGVAFFNKFKLVINALDNKKARSHVNRMCLSCQIPLIESGTMGYNGQVEFIKKGVSMC
    YECNPRSEPRTYPM
    CTIRNTPKEPIHCIIWAKFLFNQLFGETDEDVSMDEDGKIGSEKLSARNWAIQNNYDPKKLFKKVF
    FDDIKVLLNLEHLYAEKNIKPVLLDESLLDQEHTKYSDVLDSEMLTLEQNISMFWDCVTPIKEKWERSANKCLVWDKDDD
    MMMNFVVSCSNLRSAIFNIPFKTHFDIKSMAGNIIPAIATANAMIAGQIVIHALRILRGKFEKCQNVFLRSMPNHKGGVL
    VKDKCIQPPNPKCNVCSSKGEIVFVTDMHNFTVRQLEELVLKKKLNMVAPDVTMLDRVIISSDETDGVDMYDMTLSEAGM
    TNGCSFDAEDDHQNFRVKIIAYDKEKSGEEDLDFEILNNINDLRTANEQNNKTKPDENDEDDDDDDEDDCVIEQAASPAG
    STVCDNNGGAVNYVMVDEEEIGHDEVTEEIGNEEEDTEKISNEEVDAEEISNEEKLAIKRKADEAIEDINDAKKSRVD

    >gi|193615479|ref|XP_001946137.1| PREDICTED: similar to putative cytosolic thioredoxin peroxidase [Acyrthosiphon pisum]
    MVLVLEQPAPKFKGTAVVNGEFKDISLESFKGKYVVLFFYPLDFTFVCPTEIIAFSDRANEFAAINCQLIAASCDSHFSH
    LAWVNTARNEGGLGKMQIPLLADKSASIAKDYQVYNEATGIPYRGLFIIDDKGNLRQITINDLPVGRSVDETLRLVQAFQ
    YTDEHGEVCPANWKPGSKTINPSKSKDYFKTVE

    >gi|193617683|ref|XP_001943759.1| PREDICTED: similar to ubiquitin-activating enzyme E1c, partial [Acyrthosiphon pisum]
    GCELLKDLAMMGFGDVHVIDMDTIDLSNLNRQFLFRRKDVNSSKAEVAAKFINERVPTCRVTPHHCKIQDKSEDFYRNFH
    FVVCGLDSVVARRWINGMLISLLSYDDNQQLDNSTVIPLIDGGTEGFKGNVRVIIPGITPCIDCTLDLFPPQVTYPL
    CTI
    ASTPRLPEHCIEYVKLIQWPKENPFDSNIDTDDPVHISWIYEKSLERADEFGINGVNYRLVQGVIKNIIPAVASTNAVIA
    AACVTEAFKVATSCCPLLNNYAVFNNADGIYTYTYEAERKSDCITCSPRKAKYLDIDDTNMRLEKIIEILCEHQQYQMKN
    PALTIELDGKRKTLYMPNVPSIELKTRPNLKMTLEQLGIADGCKLLVADITNPRAFEIILKIKNNCVSME

    >gi|193697412|ref|XP_001952687.1| PREDICTED: similar to MGC142822 protein [Acyrthosiphon pisum]
    MEKIKNRLAQERSPYLLQHAENPVQWYPWGDEAFEKARSEKKLIFLSVGYSTCHWCHVMEHESFENQDVAAVMNEHYVNI
    KVDREERPDVDQLYMTFVQAASGQGGWPMSVFLTPDLKPIGGGTYYPPEDAYGRPGFKTILLHMAKRWKSDSKSMLENSS
    KMMKILNDTTAFDIQLGTELSNIMKPNPKTWITCYSQLQRIYDDEWGGFGMPPKFPQPTILDFLFHISHKMSKSSEGKKS
    LEMALETLQKMTMGGIHDHIGQYQVSTLLWLMITAYARAASALNVEEYKQRAIKAAEFLKTHAWNNSVLLRSCYVNDIGD
    IANIEKPIAGFLNDYAFLIRGLLDLYECTLQSKWLKWADELQEQQDELFWDKEKFGYYSSSDKDPSIILRFKSDHDGAEP
    SGNSISALNLLRLSILTEKSEYRSKIDPLFLAFAGRLSGSSSALPALVSALTLHCDSITSVYVTGDLDNPELEALLSAIR
    QRYMPNLVLAHADENSLSELAKGLGIAENGKVAAYVCKNNTCNLPVHSTEELIALLDGRVESPASN

    >gi|193613176|ref|XP_001947476.1| PREDICTED: similar to viral IAP-associated factor, putative [Acyrthosiphon pisum]
    MADLESKLLGEKLHYYCSSSDEDEPMLDRDPPKQSKSDWDGTSSNTGPKGVLNDWEQYKRQQSAQRIQREKDVLKQINDM
    ALTCKSEAEELDDQFLAEYRKKRMKEMMAKTQEAPEFGKVFDLLTGDDFLVAVENENPYVTVIVHVYEHNVPT
    CSIMNSC
    LKVLCREFQKTKFCKLIGSSAGMSLNFKMCGVPALLAYRAGQLVGNFVRITDELGDDFYAGDVENFLIEHGVLSDKSCIP
    SIMTNENDNDDDI

    >gi|193613180|ref|XP_001947424.1| PREDICTED: similar to CG4511 CG4511-PA isoform 2 [Acyrthosiphon pisum]
    MENVLEKQLLKVAESIEQKLDQEIQKLDELDLDSIENIREHRLQQMKKMIKQKEEWMAKGHGEYEELSDEKSFFEKSKLS
    PNMVLHFYKDGSTR
    CKIVDHHLKILCAQHLETRFVKLNVTRFPFLTERMKIRVIPTIVSIVDSISKDFIVGFTELGNCDD
    FSTEMLEWRLARSQVIDYKGDLINPPDVVKNNRTMLLEKNKTIRGYIGNDSDGLDSD

    >gi|193613184|ref|XP_001947382.1| PREDICTED: similar to CG4511 CG4511-PA isoform 1 [Acyrthosiphon pisum]
    MENVLEKQLLKVAESIEQKLDQEIQKLDELDLDSIENIREHRLQQMKKMIKQKEEWMAKGHGEYEELSDEKSFFEKSKLS
    PNMVLHFYKDGSTR
    CKIVDHHLKILCAQHLETRFVKLNVTRFPFLTERMKIRVIPTIVSIVDSISKDFIVGFTELGNCDD
    FSTEMLEWRLARSQVIDYKGDLINPPDVVKNNRTMLLEKNKTIRGYIGNDSDGLDSD

    >gi|193627310|ref|XP_001947930.1| PREDICTED: similar to SJCHGC01281 protein isoform 1 [Acyrthosiphon pisum]
    MFRKFASAVSTVRLAQQNFQNIPKFRQISITNSVTRSFSSSPVFNIKVQEAAPQFEGKAIIDGQIKDIKLSDFAGKYLVL
    FFYPLDFTFV
    CPTELVSFSDHIDEFKKIGVNIVGCSCDSHFSHLAFVNTPRKHGGLGGLCYPLLSDYNKEIAKAYDVLIE
    PDGIPLRGLFIIDPKGIIRQITINDLPVGRSVDEVLRLVQAFQFVDKHGEVCPMNWKPNSPTIKPDPNLSKEYFGKVNK

    >gi|193627312|ref|XP_001948034.1| PREDICTED: similar to SJCHGC01281 protein isoform 2 [Acyrthosiphon pisum]
    MFRKFASAVSTVRLAQQNFQNIPKFRQISITNSVTRSFSSSPVFNIKVQEAAPQFEGKAIIDGQIKDIKLSDFAGKYLVL
    FFYPLDFTFV
    CPTELVSFSDHIDEFKKIGVNIVGCSCDSHFSHLAFVNTPRKHGGLGGLCYPLLSDYNKEIAKAYDVLIE
    PDGIPLRGLFIIDPKGIIRQITINDLPVGRSVDEVLRLVQAFQFVDKHGEVCPMNWKPNSPTIKPDPNLSKEYFGKVNK

    >gi|193709350|ref|XP_001948804.1| PREDICTED: similar to Os03g0358100 [Acyrthosiphon pisum]
    MKVQEYVLPIFAAISFWAVPIAARGSQGFPYESLDWPTSADISGSSPTGCDKSSSTGYDKSSEEDNCDGTSCGNIYKYTA
    KKPNGQNVCLKQYVGKVLIVVNYASA
    CGFTYDNVCTLSEFAQKYRKCGLEILVFPSNDFLQNIGGNIAAEELANNHPEFE
    VFSEICVNGRAQHPVYRFLKYKLPGPFNTKTIKWNFTKFVVDRNGCPVQRYEATDSFKDIEELVQELLKDQCC

    >gi|193671691|ref|XP_001947091.1| PREDICTED: similar to protein disulfide isomerase, putative [Acyrthosiphon pisum]
    MMISNILTTTLSVGFIVSVILLKDVRSSRVLELSDKFIEMKHDGHWFIMFYAPWCGHCKRLEPIWRHVAQALHHSDIRVG
    KIDCTRYKRVVSEFGLSGYPTIMFFRDREGEFKFNSERSTEEMVHFAKRLARPPVQEVTDSKDIEMLKQTNKNFFMFIGK
    SVGHTWDLFYDLAKQYQAHSYFYITPEITGKQHFVFGETPAVVVYKEEQHYSFNAEEWDMDFNTSLTQWINTERFDTFVK
    VTRSNIHHMLETNKYLVLALVEENKIEKLPPQHSEFLQMVESVIVKNRERFHRNFQFGWIGSPEFANSITSSDVTLPSLI
    IYNSSTRHHHFPEEKPHELTPESITLFLEAVRNQSVKAYGGSGVFIQMYRMYYETKKSLVNIWVNNPAVASVLFGLPIGF
    LLLICYSTCCTDIMDASDDDEDDVHHEKKE

    >gi|193608355|ref|XP_001950574.1| PREDICTED: similar to CG6776 CG6776-PA [Acyrthosiphon pisum]
    MAIKHLSKDSVEPPKVPGSLRFYSMRFCPYAQRVQLILNAKGMPHDTVFIDLSDKPEWYLKIFPAGKVPALIYDDKFLSE
    SLLLADFLDKQYPEPPLQASSPLQTILDKLVIESFGKVGTAFYKLIMTTKEIEKQNFDELVASLIPIETELVERGTKFFG
    GNKPNMVDYMIWPWFERLDAINPYSNGTFVIPFEDKFPRLAEWKSLMIADKAVAPYYITPEKHAEHFTKRKAGLPAYDI

    >gi|193624790|ref|XP_001947074.1| PREDICTED: similar to CG41378 CG41378-PA [Acyrthosiphon pisum]
    MYLTNMRLLKVFSSYKFRFCIAFIVVLSFWQIFRAITNSNKQKLIHSSRDLNHDTSLVAKSVKDMKYLPVGVYYEALCPD
    SRNFILQHLVPSFNKAPNSFDIEFVPYGKAKTHENADGSIIFACQHGPVECHANKIHSCATQHIKDKEVLVKYVSCMIDN
    NYDPEMIGMLCAKKYNVNWNKIYTCSEGKEGELLLKLNGEATDKLWPQVSFIPTILINHEQPRQASVLKDFWGVACSYFP
    PESKPAAC

    >gi|193613234|ref|XP_001945540.1| PREDICTED: similar to copper-transporting ATPase 1 [Acyrthosiphon pisum]
    MPSEDIFELYSPLKQTDEKKPLPPNNISDKLIDSETVERHKTIILTVVSRAAEAASVILDQTGIIQVVTIGPNYLRVLYD
    VNQTSFSIFVEVLKKMGYLVSFEPEKQTEVTIQVEGMK
    CNSCVKKIEGCVREKNGVFSIQVNLEQKCANVVYDSNAISVF
    ELQSIIAELGFTVPIHQTTTVIKVDGMS
    CKNCVRNIESKIGALNGVVSVSVSLEQKEATIVHRPGDINDSQLASAISNLS
    TKFKVSLNNQKIEAPSNVFSMFVPEDEYSKTYLNIKGMT
    CASCVIAIEKHCLKIKGVKSVLVALMAAKAEVQYDPALVQP
    EDVANSVTDLGFPCNVLADTNSRITQTEFRIGGMT
    CSSCVNKIESNLIKLKGVQTAIVALTTQKGVITYDCDLISPRDIA
    DHIVSLGFTADLVNNKDRGDRSYLNHSEEIKKWRNSFFVSLLFGGPCMIAMTYFMMGMTFNFIDHSSMCCVIPGLSLENL
    IMFLLSTPVQFIGGWHFHVQAWKAIRHYTTNMDVLVSVATTISYVYSVIVVLIAITETPAKHTSPMTFFDTPPMLFVFIS
    LGRWMEHIAKGKTSEALSKLLSLKATDALLVTITDDFQILTEKEINVDLVKRGDILKVLPSTKVPVDGKVIHGRSACDES
    LITGESMPVNKKPSSLIIGGSLNQTAPLLMVATYTGEATMLAQIVRLVEQAQTSKAPIQQFADRIAGYFVPAVVAISTIT
    LVSWLFIGRYYTKYLPISDNEKYGPDGWENAIQYSFRCALSVLAIACPCALGLATPTAVMVGTGIGALNGILIKGADALE
    NAHKVKYVVFDKTGTITYGKPTVSRICLFVDDMICSLSLLLSIVANAEVSSEHPLASALVKFIKEMFKCEISGKCERFQS
    VAGCGIKCVVSHIDDLFKNGTKSDFIMNYQNHIRSGTKESSFEFNNIIVELVLGKPPTQVQSIQLHKLLDINEEKKPNET
    KYEVLIGNREWMFRNGVNLSKEVNFKMISEETLGHTAIMCAINGLLVATISVSDMVKPEAHLAVYTLMKRGYQVMLLTGD
    NRKTASAVAKQVGIQRVFAEVLPSHKVAKIRALQEKGIRVAMVGDGVNDSPALAQANVGIAISSGTDVAVEAADVVLMRN
    DLLDVVSCFDLSNKTVRRIRLNFLFASMYNLIGIPIAAGVFSPLGITLQPWMAAAAMALSSVSVVGSSLLLKIYKKPTSA
    TLTTPEYLSRSQTELDTISLHRGLDDIEPSIMIRASTSSTISKLLMGKTTVSEAENQLLNSYEDTEDHDIGNYVERTKSI
    NA

    >gi|193716129|ref|XP_001943742.1| PREDICTED: similar to Iron-sulfur cluster assembly 2 homolog, mitochondrial precursor (HESB-like domain-containing protein 1) [Acyrthosiphon pisum]
    MTFTMLMARNVRKCFKFITAPQTIRQMSSKLAEEDLKVTDDCVKRLEAICDKDEFLRLCVESGGCSGYQYKFELDRTIAN
    DDCVLETQGIKIVVDTTSLNYIRGSTIDYEQQLIRAAFRLIRNPKAEDGCSCGASFSIKID

    >gi|193629763|ref|XP_001951326.1| PREDICTED: similar to AGAP011549-PA, partial [Acyrthosiphon pisum]
    MYFPHILLFLTVCRLALAEFEENVHIDDSKFGPLEQPDTPKNLTIAPQITDFTDILTISNAIKSFQKKMEEEHNYLPTMQ
    AYLTTSTASNGGKEFKLSTFLSSVIYAEITTDNTNTSQPSINEPLANVTAANNSRIVNCTTLLHLNQTVFSVEVVNSSRL
    GYVLKYDPEVTNRRESGVCSLVLFYARS
    CQFSTLAAPHFNVLPRIFPQLKMVAFNAISEQRFNTMYGITGVPSLVLFHNG
    KPIAKYNGSDYSLYEFTKFVIRHT

    >gi|193624784|ref|XP_001945659.1| PREDICTED: similar to thioredoxin domain containing 11 [Acyrthosiphon pisum]
    MKTVVEEEAIKEQPDEATHQPFNRYKQLKMFVRRLGKELLFALIVTCTTYATIINIQNDYDIKGPKPKPFFRANSCVEDF
    YTGNLKAVLEKATLADVAVVMFYAPWDADSIDSQEAFIEACENNIDEVYFAAINCWQPESICSKVLKGNKVYPMIVAYDY
    TKVGIYYSGPPNDAAYITRFVDTMKRPVKLLNSKLDLLKVHQQYHNVLVASVDFKITQGWDIYKIVLDAAINHLKADPLQ
    TYVKWCVATWPLSSKEPLIKLLLWNHTLAFNESFVNHETLGKWVIEETRLTTRWVPSIARSRSLILDNSFKSGPTMLLFT
    PHNPYLNFNPIYSMFQLLTFYNERPKYVKQCHEIIMNKYPDKMAGILKKHNATIKVENQDNFDLDTNVEMNYLNKALCKM
    SKSIFFDHKISYCSNDLDKSSKKIAKINLSNHVSTEQFIEQLKETECYRNLLANKYFRFSKPDEAFIFNTTDALKTACLA
    NKSMTFLALDSNHHYHTAKVFGINLNHYRERTAVVIYDMKSEMVHTLPKSSHVTKDTMTKLLIDFLENRAKRHLRSSADL
    DINFHLYQGKGKGKETVYIETLNSNTFNDAVFNNTDNVVVYFYTPFCAY
    CQVVAHVLLSVARLMRNVKDLKFFRFNASNN
    DLSWHLTVQTYPSIIIFPAKKKAESYVFPYNTELTSNNLSQFILSNLLLETRLQAMVGLCTVWDSSEDYNKQLHYCLRDI
    KLDCDANISKSLQSYRRGLVYREKNKNVTLTPIFNRLRYLKAFSLILDVTHKLNSKSMQKFTEIYNF