Brachybacterium faecium DSM 4810 uid58649

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|257067387|ref|YP_003153642.1| dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis [Brachybacterium faecium DSM 4810]
    MTDTAPAAQSLPPLVAPGPELTSQQLQRYRRQITLPQIGTIGQRRLRAASVLVVGAGGLGSPALQYLAGAGIGTLGILDD
    DLVDTSNLHRQVIHTTSAIGVPKTASAAAAVHALNPEVRVHTHPERLTPESVTGIVENYDLVLDGSDNFATRYAVADASE
    ITGVPVVWAAVLRGQGQVSVFWPGRGAHYRDVFPEPPAPGEVPS
    CAEGGVLGTLPGLLGMIMGAQVIQLVTGTGEPLVGK
    LLLWDEATSTSRTLRLIPDPHRTRSTQVEVPAAADPSCRSGVPAASETLDVLALRSLLASGADVTLIDVREDWEHAAGTI
    EGAIPVPLQQILEHGEHALPTGRGGGEIVLY
    CQAGARSASALERLRPAWSGREGRVRHLGGGYDAWTAPTKHT

    >gi|257067522|ref|YP_003153777.1| predicted redox protein, regulator of disulfide bond formation [Brachybacterium faecium DSM 4810]
    MPRTVVSNASTAWKGDLLAGSGTTTLDTSQLGTFDLSWKARSEESEKGTTSPEELLGAAHAACYSMQFSNMLAENGTPPT
    SVDTAAAVGFNIGEGGITGIELTVTAKIDGIDEDDFQRIADEAKSS
    CPVSKALAGVDITLKATLA

    >gi|257067569|ref|YP_003153824.1| rhodanese-related sulfurtransferase [Brachybacterium faecium DSM 4810]
    MTVPADPTPALQDYARPEKLVTTQWLADQLAAGRPADLVVVESDEDVLLYETGHIPGAVKIDWHLDLNDPVTRDYVDGEG
    FAKLMDASGITRETTVVIYGDKSNWWAAYALWVFELFGHQDVRLLDGGRAAWEAEGREMTTSEEGKPSATTGYPVVQRED
    APIRAYREDVLEVLGGPLIDVRSPQEYTGERTHMPDYPQEGTVRGGHIPTARSVPWARAAAADGRFKPRAELQEIYQDEL
    GFDTAEPTIVY
    CRIGERSAHTWFVLTYLLGFENVRNYDGSWTEWGNAVRLPIAQGTEPGEVPAR

    >gi|257067634|ref|YP_003153889.1| thioredoxin reductase [Brachybacterium faecium DSM 4810]
    MTPSSAVSSTVFSASSTSAPATSSAASSSAVEHGDQLPEGLVDLAVIGGGAAGLSSALMLARSRRSVVVLDAGAPRNAPA
    EGIHALLGNEGTPPAQYLERGRAEVRQYGGLVVPAEVVAARGAAPAADGDLRFEIVLADGRRLTSRRLVVAVGIRDELPE
    IPGLAAHWGRGLVH
    CPFCHGWEVRDQAIGVIATRPASFHQALMFRAVTEDLTMFTQGLEVDAETRERCEALGITILKAPI
    EEIVAGPDGGVAGVRLAGGELVPRTVLAAATVMTPRLDGLDELGLTLEEIPAGMGQKITTAMAGSTDVPGVWAVGNSADP
    SAQVGAAAAGGALAGGHIHGTLLMVDAEAAVATHRAAPRVA

    >gi|257067677|ref|YP_003153932.1| YeeE/YedE family protein (DUF395) [Brachybacterium faecium DSM 4810]
    MILTGLLLGAALGYVLQRSRFCVTGAFRDLYLARSTRYFTPFLLAIAIQAVGVAALTGVGVIAPEPASFAPLAVIGGGLL
    FGVGIIMAGG
    CATGTYYRAGEGLIGSWVALIFYALFAAVMKYGPLGSFTEAARARTVADATLQETLGVSVWVPVIAFSAL
    VGVLVVRQVRASAARSTGRTAVRLPARRTGLGHYLADIPWNPWVGGVLLGIIAIAAWVLSTAAGRNGGLGITTPSAKIAT
    FLTTGDVTLVDWSVMLVLGILLGSFIAAKLAGEFRWRVPDSGTILRSAGGGITMGVGAALAGG
    CTIGNSLVETSLFSYQG
    WVSLIAIMLGTWGAAWFFLVRPQKAAAASRPAPVLTPAA

    >gi|257067762|ref|YP_003154017.1| alkylhydroperoxidase AhpD family core domain [Brachybacterium faecium DSM 4810]
    MTRPETFTQESLNWVPWLEPVAREDLTEEQHEALLDDFRRAMPYFRLLARDPQALLARTLTDKDIFFNTDGGAGRAEREL
    AATATSRANGCIY
    CASVHSASATRESGRVDDVQRLLDDGVGADLGSETWNAIAHAADVLTHLPLDFGPGEIQRLRAAGLD
    DADIVDVINGAAFFHWANRLMLSLGEPEVPSRRKERS

    >gi|257067807|ref|YP_003154062.1| glutathione peroxidase [Brachybacterium faecium DSM 4810]
    MAAPTFHDFSAATIDGERRSMSEYRGRLALVVNIATQCAFTPQLASLQELHDRYAAHGFTVLGFPSDQFRQDPGTDEDTK
    EFCTSAYELTFPLFSKIDVNGPTAHPLWQWMCAQKAGVIGGRIAWNFTKFLIDGEGMVLRRYAPPVPPVRIARRIESELG
    LR

    >gi|257067848|ref|YP_003154103.1| rhodanese-related sulfurtransferase [Brachybacterium faecium DSM 4810]
    MTSASSAPHPSSRSERGSSAPAAPSAGPAPAALPPLLDTAQLHALREDAAAGGRALHLLDVRWALDGSKGHDTYLAGHLP
    GAVYLDLDTELAAPARPDAGRHPLPEPEDFAASLRRAGVTEGAAIVAYDDTTGAPAGRLVWMLRALGHDAAVLNGGLAAW
    DGPLSTEPVSPEPGDVTARPWPAGRVATADEVAAGEALVVDARAPERYRGEVEPMDPRAGHVPGAVNLPFAGNLDGEGRF
    MDPQELRRRFEAAGVSEERETIVY
    CGSGITATHDLLALESAGFTRLRLFPGSWSQWSAQESRPVAVGPNP

    >gi|257067915|ref|YP_003154170.1| Peroxiredoxin [Brachybacterium faecium DSM 4810]
    MSSAPVKLAVGEDAPAFDLPTAGGGRVDLASLRGAPVLLWFYPAANTSLCTKQACDLRDNHQMFLDAGYRVIGVSPDPVA
    ELDRFVAEQELPYTLASDESHEVMEAYGAWGEKNMYGRIVEGTIRSTFAIDAEGVLSFVKYRVGTPKHIALLQEKLGL

    >gi|257068017|ref|YP_003154272.1| Peroxiredoxin [Brachybacterium faecium DSM 4810]
    MPQQLSPGDRAPDLDLADTRGDRVTLADLHGRRTVVYFYPKAFTPGCTTEACDFRDHESALDERGYRILGISADTPDTLA
    DFATTYELPFTLLSDPDSRTARAWGAWGEREIAGERSEGPLRSTIVLDEDGVVLAADYAVGAAGHVATLIDTLGSRP

    >gi|257068029|ref|YP_003154284.1| methionine-S-sulfoxide reductase [Brachybacterium faecium DSM 4810]
    MERAGTTVTPMWQMMDLLYAHKKDMVAPEDALPGRAGYPYALAREHLVLGTDMLGPEAPVDPRPWPAGTEELILAGGCFW
    GIERIAWQVPGVHTTSSGYAGGFTPHPTYEEVFSARTGHAEAVRVIYAGGEETLRALLSQFWEQHDPTTANRQGNDVGTE
    YRSAVYWTAAAQGEVVRDSASRYQRALDEAGRGAITTELRPLSEAGDGVYYTAEPEHQQFLAKNPGGYCNHGFNGVACSL


    >gi|257068043|ref|YP_003154298.1| dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis [Brachybacterium faecium DSM 4810]
    MTGPTPCGGAPVSLRERAVPADRVEQLGEDAQRYLRQQRLPQLGETGQRRLAGARVAVIGAGGLGAPVLSYLAAAGVGEI
    TLFDPDTVDETNLHRQVLFTTADVGLAKAVAAAAHLHAQNPGVVVRAVVDTLTPATALEELAGHDLVLDGTDNFPTRYLA
    SDACEILDIPLVWGSILAFSGQVSVFWGAGGRGVTYRDVHPVPPQPGEVPS
    CSEAGVLGMLCGVIGSTMAMEAVKVLAGM
    GEVLFGRLALYDALRARWDEIPVARDPARRPVDSLEDVALTCGLPGPTGPALDEVTAAELPGLLEAGARVIDIREEHELG
    GGMLRGAEHVPMRQLLAGAAAQAAGELGDLEGAVLYCAAGTRSASAQRQLAEHGIRVTSLRGGFDGLARLGASGTGLVTG
    APR

    >gi|257068105|ref|YP_003154360.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Brachybacterium faecium DSM 4810]
    MNAPTHYDIALIGSGSANSFPGPEFADRRIVQIDRGVGPDRVFGGTCLNLGCIPTKMFVHTADLAHATTDAARFGLTEQL
    QDVDWPAIRDRIFGRIDPITAGGEEYRRDHEDNANLTLLRGTARFIGDRTLHVIGEDGGEQTVTADTVVLGAGSRPALPP
    VDGLAEAAPHTSDTIMRIERLPASLAILGSGVIAVEMAHIFASLGVEVTLVARSQQVLRDADADISARLTELLGQRLRLE
    KGLSTTSVRRTGAGVELRGVQDGAEVLIEAEELLVATGRRPNSDLLDVAAAGIDTAEDGRVRVDAHQRVLGGGRVLEGLW
    AFGDLSSAHQLKHVANHEQRIVRHNILHPGQLRRSDTMPVPSGVFTHPQVAWVGMDEETARAGGRGVKVAVQEYASIAYG
    WALEDSTGFAKIIADAETTEILGAHLIGPEATTLVQLLIQAMSTGQTARDIAATQYWIHPAMPELIENALLQLVP

    >gi|257068135|ref|YP_003154390.1| O-6-methylguanine DNA methyltransferase [Brachybacterium faecium DSM 4810]
    MTPSRPADTARPRHRRIATPLGLYLIAAEGAAVTGLWRQDQSRFPGPERLGPAAPSPDPLLDVAEQQLLAYLAGEREEFD
    LPLDLRGTAFQQEVWTLLRTIPRGSTTTYGQIARALGRPRAAQAVGAAVGANPLSIVVP
    CHRVVGSSGAITGYAGGIETK
    QALLLLEGALLA

    >gi|257068149|ref|YP_003154404.1| selenophosphate synthase [Brachybacterium faecium DSM 4810]
    MSDSPIRPAAQPSIRLTTMAHGGGCASKIPPGELEEVVAGLSGQQYPQVIVGLEDGDDAAAVRIGEAGDTAVLSTADFFT
    PVVDDAFDWGRIAAANALSDIYAMGGDPVVAINLVGWPRGVLPLELLQEVLSGGLAIAQEAAVPVIGGHSVDDPEPKYGM
    AVTGTALPERLLRNDAAAPGLPITLTKPLGVGLLNNRMKSTGEVSEAAIATMTTLNRDASKAALAAGARAATDVTGFGLL
    GHLFKMGRASGVGMVIDRAAVPLIEGADDALRDGFVSGGTRRNLEWVRHAVQAGAGITEEDLLLLADAQTSGGLLVVGEV
    PGYPIIGETVEGSGITVR

    >gi|257068346|ref|YP_003154601.1| hypothetical protein Bfae_11650 [Brachybacterium faecium DSM 4810]
    MTARTVELFVDPVCPFAWMTSRWLLHAAEVREVTPKFSVMSLSVLNEGRDLDPGYRASMDDAWGPARLAIAIGRAEGEEA
    VARWYTAWGERFHVGGESSDRRATAVAALADAGLPESLIEAYAPVAGDEVDQALRASHARALSRVGDEVGTPVISFGEGT
    AYFGPVVSPAPKGEEAGKLLDALATMATIDGFYELKRSRTGGVDLS

    >gi|257068549|ref|YP_003154804.1| methionine-R-sulfoxide reductase [Brachybacterium faecium DSM 4810]
    MSTEPIGTRPYPLTVSDLEWRERLSPAEYQVLRQGGTERPGTGEYEEVRPAGTYACKGCGAELFTAQTQFDAHCGWPAFY
    APTDSDAVELLEDTSLGMRRIEVRCASCGSHLGHVFEGEGFATPTDQRY
    CINSISLVHSDDSASGTSA

    >gi|257068571|ref|YP_003154826.1| thioredoxin [Brachybacterium faecium DSM 4810]
    MATLTLTTENHDKTVEDGIVLIDFWAGWCVPCQRFAPIFEESSETHEDVTFAKVDTEDQQELAMRYGVTSIPTLVAYREG
    IPVFSQAGALPQSALEDLIGQVKNLDMDEVRKAYAEAQEKQD

    >gi|257068577|ref|YP_003154832.1| Iron-sulfur cluster assembly accessory protein [Brachybacterium faecium DSM 4810]
    MTTTTERPTAAHGVTLTSGAAQKVTTLLEQEGRDDLRLRIAVQPGGCSGLIYQLYFDERTMDDDLVVDFEGVEVVVDKMS
    NPYLTGAVIDFSDTIEKQGFTIDNPNAGGSCACGDSFA

    >gi|257068804|ref|YP_003155059.1| dihydrolipoamide dehydrogenase [Brachybacterium faecium DSM 4810]
    MAETTTDQFDVVILGGGSGGYAAALRGAQLGQKIALVEKDKLGGTCLHRGCVPTKALLHVGELADAPSEAAAAGVDLSLN
    GIDAAKVLGFKDKIIGRLHKGLQGLVKSRKVEYVEGFGTLTGANTVSVETESGTRTLTGKNIILASGSFSKTLPGIDLGG
    RFLDSEAALQLPEIPKNPIILGGGVIGVEFASVWKSLGAESVTIIEGLPHLVANEDEALSKALERAYKKRGIAFSLGVFT
    EKAEQTEDGVKVTLADGKVFEGDYLLVAVGRGPNTTGLGYEEQGIEMDRGFVLAEAETLETSVPGIYAVGDIVPGLQLAH
    RGFAQGIFVAERIAGLNPAPIVESGIERITYCEPELGSVGLSEKQAKEQLGADAVEVYEYNLGGNGKSQILGTTGFIKLV
    REKDGPIIGVHMIGTRTSELMGEALLIVNWEAYPEDVASLIHGHPSQHEALGEAALALAGKPLHAHA

    >gi|257068933|ref|YP_003155188.1| alkylhydroperoxidase AhpD family core domain [Brachybacterium faecium DSM 4810]
    MTAVSAPVDAHEILAALLTDAPEGGELRAVLRPDVLTHTRAAYDALYRAPQPLPAAVLHALAAVSAEWQGSGPLAEWHRS
    QGASAALLAADPLTEDPALAALRDHVDALSLSPALVTLADQERLADAGHDPRTAVLLSQLVSFESYLQRLVAGLAALRGL
    EVPAADAPVRTPRTRDRAAAHGGTTRTGRIRPAHFTREQLEWEPWIAVPEEGELTDEQRDSFASKSSANSVYFRMLSLTP
    SVTRARSLLDNAIFLPRDGLPKAERELAAAVTSKVNDCIY
    CASVHARKAAALAKREAEVEALLAAPLERDADWIAAELSP
    LGAGQDERWAAIITAAAELSRPRPSAVPLAPLRAQGLTDPEIADLLCAAAFFAWANRLMLSLGDPSLPDAA

    >gi|257069126|ref|YP_003155381.1| copper/silver-translocating P-type ATPase [Brachybacterium faecium DSM 4810]
    MSTPPSPLPLGADIELEIGGMTCASCANRIERKLNKLDGVSAAVNYATEKARVSAPAEYDVQDLITVVEQSGYSAVLPAS
    RQDSAAADEDEEREDPELRSLRHRLLGAVLLSVPVIVISMIPALQFTHWQWAALTLTAPVIVWAAWPFHRAAALNLRQGT
    ATMDTLISVGTIAAFLWSLYALFLGSAGEPGMTHEFSLTIGRTDGSANIYLEVAAGVTMFILLGRYFEKRSKRQAGAALR
    ALLDMGAKDVAVRRDGVEIRIPVGELAVGDEFVVRPGEKIATDGVVVSGSSAVDASMLTGESVPVEVGQGDAVTGATVNA
    GGRLVVRATRVGSDTQLAQMAKMVEDAQSGKAEIQRLADRVSGVFVPVVIAVAVIVLGAWIGAGFPLEAAFTAAVAVLII
    ACPCALGLATPTALLVGTGRGAQMGILLKGPEVLESTRAVDTVVLDKTGTVTTGTMTLTEAVTAERVDRLELLRHAGAVE
    DSSEHPIARAIARGAAAEAGPLPVLEDFENLAGRGVRGTVEGRTVLVGRTSLLEGRALPEPLQAALEAAQARGRTAVVVV
    RDGAADGVLVVADAVKPSSAQAISQFKGLGLSPLLLTGDHRAVAEQIAAEVGIEEVIAEVLPQDKVDVITRLQGEGKVVA
    MVGDGVNDAAALAQADLGLAMGTGTDVAIEAGDITLVRGDLRSAADAIRLSRRTLSTIKGNLFWAFAYNTAAIPLAALGL
    LNPMLAGAAMAFSSVFVVGNSLRLRSFRSRALDAPQSSTSAQQPVPAT

    >gi|257069352|ref|YP_003155607.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Brachybacterium faecium DSM 4810]
    MASITFKNDPVTTVGELPAKGSALPAFELVGQDLAPVTSADLAGKRVVLNIFPSLDTGTCAMSVRKFNELAAGLENTVVV
    CVSEDLPFAQARFCGAEGIDNVVTGSAFRSSFGEDYGVTMQDGPLAGLLSRAVVVTDADGTVVHTQQVSEVSEEPDYEAA
    KAALA

    >gi|257069552|ref|YP_003155807.1| thiol-disulfide isomerase-like thioredoxin [Brachybacterium faecium DSM 4810]
    MNAHLTRRGLLGAVGGAAGALLLAACGTDTSDRYASGDSGYISGDGVSTEIAPEDRGEALEITGTTYDGEDFASAEHHGE
    VLVLNVWYAS
    CPPCRKEAPELQKIHEEYQDRGVSFIGVNVRDAEGPARAFEETYGITYPSMPDADAEIMYSLRGQVAPNA
    VPSTLVLDHEGRVAARVSGAADPSVLRAMIDAVVDE

    >gi|257069571|ref|YP_003155826.1| copper chaperone [Brachybacterium faecium DSM 4810]
    MTSTTGSSTRSLFRAEGFSCPSCVAKIEKRVGRLPGVQHVAVKFASGRVEVEHDPALTTADEIIAAIGKAGYPAVLSAF

    >gi|257069593|ref|YP_003155848.1| protein-disulfide isomerase [Brachybacterium faecium DSM 4810]
    MTAPDRPDAPRGPDSPRGSDSPQSHRAARPAGRRWMVPLLILVVAAALIAAVLWLRPGGDSTEPAASTDSTDVADAPADG
    AEAEDPGAVEHPSSVAVPDLSEEEARDEDDLLAEGPVDAPVVLIVFTDYQ
    CPYCAEWSQETLPAVREYVERGELRIEWRD
    VNIYGDDSERAARASLAAARQDAHAEYHDRLFEGGEIRTGAELDESSLVALADELGLDTEQFTEDLHSEEVAETISANAS
    QGWDLGIMSTPAFVVGGTPMVGAQPTDVFTTAIDDALAESGS

    >gi|257069614|ref|YP_003155869.1| ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [Brachybacterium faecium DSM 4810]
    MYSKPLCVQCDATKRALNKAGIAYDVVDITEDADALAKVKSLGYVQAPVVITSEDHWSGFRPDKIKALAGAGAQRQAAAI


    >gi|257069643|ref|YP_003155898.1| NHL repeat protein [Brachybacterium faecium DSM 4810]
    MSTSSDPSTPLTARAHGSALRGRGWLNTGGAELDLEALRGKIVLLDFWTFCCVNCLHVLDELRPLEEKWAQELVVIGVHS
    PKFEFEKDPEALAANIERYEVSHPVIDDPELETWTEYGARAWPTLMVLDTHGRIAGNLSGEGHAANLDRLVEQLVAEGEA
    DGSLRRGPAPTVLAERSPQTLRFPSKLTLLPDGRLVVSDAGQHRLVVFENDGVTVDAAIGTGRRGHADGDEETAQFAEPN
    GVLALPREVADEVGYDLLVVDTAGHRLRGVKVGQDRLLRSRTATEVTTVAGSGEQWMQGAPLPRGEGDARTFALSTPWDL
    TWSHVLNRAVIAMAGVHQLWTFDPVAGTLMVLAGTTQEGLVDGPAVTSWWAQPSGLDELPDGRIVVADSETSAVRVLDPR
    SMQVTTLVGEGLFDFGHVDGPASTARLQHPLAVTALPDGRIAVSDTYNGAIRLVEEAPAEGERATTGGIAALSGVVAVPD
    RSGGGTTADGGPGAAGTQGAGANGAGGTDGPAGAEGAPTAEAHVVTVATDLDEPSDAIVGPPVDGIGQLIVVESGTHRIT
    WVPVAKAAERMIDKGAQRSERPVTDVGPGPLTVRVLFTPPPGHKLDDSLGPSTQVTVSTTPSAMLTAGDGVDTALERTLE
    LDPAYTEGVLHVSARAASCDADPTIEFPACHMHQQDWGVPIRIVEGGPTELDLSLLA

    >gi|257069672|ref|YP_003155927.1| Rhodanese-related sulfurtransferase [Brachybacterium faecium DSM 4810]
    MDMETVAPKDVPEGAHLIDVREQNEWDAGHAPGAQHLPASSLLENLEQLPEDDDELYIVCRTGGRSFQVTQWLNANGFEA
    INVDGGMDQWFESGLPIEADGEAEAYIL

    >gi|257069843|ref|YP_003156098.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Brachybacterium faecium DSM 4810]
    MARESSSPAQSTREITADVVVLGGGPVGENLAQYAIEDSDLTAVIVESELVGGECSYYACMPSKALLRPLAVADTAAHLE
    GLSTPQLDPEALRARRDTWVSHYDDSGQVEWAEGAGMTVVRGHGRLVGEREVLIDAAVGGHEHGPARSDAPADGADGAHG
    AEGVGGTDGAEGADGAARADGTETAHGRSATRTRIRARRAVVIATGSEAVVPGPLQALAPWTSRDATGVCEVPGELVIVG
    GGVVAVEAATWMAALGARVRLLVRGTSLLTGFEPFAGKHVLDALRELGVVVELGTSVVSGEREDARDTGLGRTHGGTVRL
    QVEDAAGRREVTADEVLAATGRRPALGDVGLETIGLTAEDVTGTEAATSDDATGAPLPEWLQVVGDASGEAPLTHWGKYR
    ARVIGQAIRAGALGEPLEPVPEQVPVPQVVFADPQVTSVGLTEEAARAAGHDVVTAQVPFGSAAGTALLRDDVTGTAQLV
    VDRAAGTLLGATFVGPDASELLHGATIAITGQVPVRVLRHAVPSFPTASELWLRLLEELPRALRQG

    >gi|257069914|ref|YP_003156169.1| Zn-dependent hydrolase, glyoxylase [Brachybacterium faecium DSM 4810]
    MLLERIYDEDLSQTSYLIACQASGEALVVDPRRDIQQYLDLAAQHGLRITAVTETHLHADFLSGTRELAAATGATAYVPG
    TGGEDWQYGFEAERLHDHDTLTLGRITVTARHTPGHTPEHLSYLITDGAFADEPGYILTGDFVFSGDLGRPDLLDEAVGM
    HDTRFAGAKQLFTSLKEVFLALPDHVQVFPGHGSGSACGKAIGALPSTSVGYERHFAWWGPYLKNDDEQGFIDELLDGQP
    DAHAYFARMKRQNQEGPALLGERTPPREVGAEELSRGLEQGTIALVDTRPVAQVHAGTVPGALNIPVLGKAASHIAWAFD
    PDTDDAELVVLAEDAATAAEYGDHFVRVGVDALTGFVPSLEGLPQTVPPVISPAELERQRSEGTVPRLLDVRTRTEHAAG
    TIPGAQQLSAGKVLFHQGELPAEGEGPLVTF
    CQSGLRNTVAASALRRAGHDVVELDGSYAAWAQWDAAQPDHGAQPGTAD
    QGGTQHPDRSAQPGTTDDERTA

    >gi|257070135|ref|YP_003156390.1| glutathione peroxidase [Brachybacterium faecium DSM 4810]
    MGPMTTLADFTATTITGQDQQLAEHLGSVVLVVNTASKCGLTPQYAGLQALHERFHEQGLTVLGFPCDQFMHQEPGTEEE
    ISEFCQVNYGVSFPMFAKVEVNGEGAHPLFQWLTGPHTPGGDVPDSEIPGGDIEWNFAKFLLGRDGTVLRRYAPQVEPAD
    LAEDIEEALAAGV

    >gi|257070252|ref|YP_003156507.1| hypothetical protein Bfae_31570 [Brachybacterium faecium DSM 4810]
    MESSAPSLPPLHQTYAAAVPELSIPWRAEQPPQPEIVWLNEELAAELGMDPEQLRGAEGMALLTGQIEGTTAQVYAGHQF
    GSPNPQLGDGRAVLLGDLIDTRGRRRDLHLKGAGRTPYARGGDGKAPLGPMLREAVIGEWLHATGTPTTRALAVLTTGEQ
    IAPRQGVTPEPGALLVRVAASHLRVGTFEYAAWHHDPAVTRALCEHTLARHHPSAEGPLGLLESVARSQAELVAQWMLLG
    FVHGVMNTDNMALSGEGIDYGPCAVLDAHRRDAVFSSIDRGGRYAYGNQPGIALWNLSRFAETLLPLLDAETPDAAVEQA
    TAVLERFEGWYAEAHARGLARALGITGTPEEVLALGQELFTLLEEQAVDHTGFFRALGEGGAEALFTEPAAYRDWARRRE
    ALRTASAEELLRVNPLYIPRNVHLDAALRAAHLGDPAPAREMLEAVRDPFTRRPGLAHLEGPGDGGEHFLTF
    CGT

    >gi|257070282|ref|YP_003156537.1| thioredoxin-disulfide reductase [Brachybacterium faecium DSM 4810]
    MSQPIQALNILGGPAPAAQPVPAAESPQDDTVHEVVIVGSGPAGYTAAIYSARAEMKPIVIAGALDAGGALMTTTDVENF
    PGFPSGIQGPELMTNLQEQAERFGAEVIYEDAVELELEGEIKTVTLDDGTVYRAKSLILSTGSAYRKLGVDGEAQLSGKG
    VSW
    CATCDGFFFKDQEIVVVGGGDSAVEEATFLTRFGKSVTLVHRRDELRASKIMARRAEADPKLSFAWNSEVVSINGDD
    KVESVTLRDTVTGQERVLATSAVFEAIGHLPRTDLVRGKLELDDEGYIVCEGRTTYTSVPGVFAAGDVVDHTYRQAITAA
    GTGCQAALDAERWLADMAAGIDTEDVLADATAQ

    >gi|257069556|ref|YP_003155811.1| Glutaredoxin-like domain (DUF836) [Brachybacterium faecium DSM 4810]
    MTAARIPSPHDPDARVLYLTREGCHLCDEALPVVQAEADRVGSTVEVRDIDEDPALQADWDYDVPVIIVDGKVHAKYRVD
    APQLRAALARRPWWRRLTGRG