Borrelia turicatae 91E135 uid58311

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119952864|ref|YP_945073.1| thioredoxin [Borrelia turicatae 91E135]
    MAISLTKQEFIDKVFDYKNNKEWDFKGKKPAIIDFYADWCGPCKMLAPIYDELSKEYGDRIDFYKVNTDKEQEISMALGV
    QSLPTIIFVPVGEKPRVSVGFIQKDSFEDAIKDLFKV

    >gi|119953303|ref|YP_945512.1| thioredoxin reductase [Borrelia turicatae 91E135]
    MLKFEVLDIKKSNKKVLRTEMNSIEDVIIVGSGPAGLTAGIYTVMSGYKTVILEGPEPGGQLTTTTEVYNYPGFKNGVNG
    RELMLNMKDQVINLGAITYLETVTSIEKRDNIFYLFTDNYIYKSKAVIIAAGSVPKKLNTLKNSDLFWNRGISV
    CAICDG
    HLFKGKTVAVIGGGNTAISEAIYLSKLSEKVYVIVRKDYLKAIAMLRQNVEKLPNVEILYNCEAIEVNGDNIVSMVQIID
    NKNNSTFELSVNGIFVAIGYKPNTEFVKGFLELDEDGYISTQDLVKTSVEGVFSCGDVSNKLYAQAITAAAEGFLASVEL
    RNFLG

    >gi|119953505|ref|YP_945714.1| coenzyme A disulfide reductase [Borrelia turicatae 91E135]
    MKIIIIGGTAAGTSAAAKAKRTNKELNITIYEKTNTTSFGACGLPYFIGGFFDEPNNMIARTPDEFEQNGISVFTEHEVM
    RVDIKNNTLQVKNLQTKQIFNDTYDKLMIATGGNPIIPPISNIQLSNFYTLRNMQDGKEIKKLFKKKDIKDIVIIGAGYI
    GIEMVEAAKALEKNVRIIQLDKRILTESFDREITNIMEEELIKNNVLLHTDEFAKSLIGKEKVKGIITNKSEYKADLVIL
    STGIKPATEFLEGQLETLKNGAIIVNEYGETSVKNIFSAGDCATIYNLVSKKNDYIPLATTANKLGKVIGENLAGRHVAF
    KGTLGSASIKVLSLEAARAGLTEETALKLGIKYKTVFIKDKNHTNYYPNQEDLYIKLIYNEETKEIIGAQTIGKNGAAIR
    MHALSLAIYSKLTTNEIGMMDFAYSPPFSKTWDALNVAGNAAK