Borrelia recurrentis A1 uid58793

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|203287530|ref|YP_002222545.1| thioredoxin [Borrelia recurrentis A1]
    MAISLTKQEFIDKVFDYKNNQEWNFKGTKPAIIDFYADWCGPCKMLAPIYDELSEEYGDKIDFYKVNTDKEQEVSMVLGV
    QSLPTIIFVPVGDKPRVSVGFIEKNSLKDAIKDLFKV

    >gi|203287958|ref|YP_002222973.1| thioredoxin reductase [Borrelia recurrentis A1]
    MLNFEVLDIKKCNREIIRTEVDFVEDVIIVGSGPAGLTAGIYTVMSGYKTSILEGPEPGGQLTTTTEVYNYPGFKNGING
    RELMLNMKEQAINLGATTYFETVRSIKKRGDIFCLYTDNYIYKSKSIVIASGSIPKKLDTLKNLDLFWNRGISV
    CAICDG
    HLFKGKTVAVIGGGNTAISEAIYLSKLAEKVYVIVRKNYMKAIDMLQKSIKTLSNVNILYNCEAREVSGENIVSKIHIMD
    NKHNSAFELNVDGIFIAIGYKPNTEFVKGFLELDDDGYISTQDIVKTSVNGVFSCGDVSNKLYAQAITAAAEGFLASVEV
    RNFLG

    >gi|203288157|ref|YP_002223172.1| NADH oxidase, water-forming [Borrelia recurrentis A1]
    MKIIIIGGTAAGTSAAAKAKRINKELNIVIYEKTNTTSFGACGLPYFIGKFFDEPNNMIARTPEQFKQNGISVFPKHEVT
    KVDIKNNILQVKNLQTQEIFNDTYDKLMIATGGTPIIPPINNIKLKNFYTLRNMNDGKEIRELLNKQEIKNIIIIGAGYI
    GIEMVEATKARKKNVRIIQLDKRILTESFDKEITNIMEEELIKNNVLLHTNEFVTSLIGKDKVEGIITNKSKYKADLVIL
    STGIKPATEFLEGQLDTLKNGAIIVNEYGETSAKNIFAAGDCATIYNIISNQNDYIPLATTANKLGKIIGENLAGKRVSF
    KGTLGSASIKVLSLEAARSGLTEEMALKLGIQYKTVFIKDKNHTNYYPNQEDLYIKLIYNQDTKEILGAQIIGKNGAALR
    MHALSLAIYSKLKINELGMMDFAYSPPFSKTWDALNIAGNAAK