Borrelia hermsii DAH uid59225

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|187917940|ref|YP_001883503.1| thioredoxin [Borrelia hermsii DAH]
    MVISLTKQEFIDKVFDYKNNKEWDFKGKKPAIIDFYADWCGPCKMLAPIYDELSKEYGDKIDFYKVDTDKEQEVSMVLGV
    QSLPTIIFVPVGGKPKVSVGFIQKDSFEDAIKDLFKV

    >gi|187918380|ref|YP_001883943.1| thioredoxin reductase [Borrelia hermsii DAH]
    MLKFETLDIKKSNKRIVRTEMGSVEDVVIVGSGPAGLTAGIYTVMSGYKTVVLEGPEPGGQLTTTTEVYNYPGFKNGVNG
    RELMLNMKEQVINLGATTYLETVRFIEKRDNIFYIFTDNYIYKSRAVIIAAGSVPKKLDTLKNSDLFWNKGISV
    CAICDG
    HLFKGKTAAVIGGGNTAISEAIYLSKLLKNVYVIVRRDCLKAIAMLRRDVEKLPNVEILYNCEAIEVNGDNVVSGMQIMN
    SKDNSTFKLSVDGIFIAIGYKPNTDFLKGFLELDEDGYISTQALVKTSVKGVFSCGDVSNKLYAQAITAAAEGFLASVEV
    RNFLG

    >gi|187918385|ref|YP_001883948.1| glutathione peroxidase-like BsaA [Borrelia hermsii DAH]
    MSVYGFRARLASGPEISLSDYIRKVLLIVNVASDCSYTNQYQDLEVLYKIYKRRGFLILGFPCNQFGFQEPGSNNEILKF
    CRTVYNVSFPIFSKIDVNGENAHPLYRYLREKSPEEFKGDIRWNFTKFLINREGNVVGRYTPKIAPIKMKDDIEKWLSVI


    >gi|187918583|ref|YP_001884146.1| coenzyme A disulfide reductase [Borrelia hermsii DAH]
    MKIIIIGGTAAGTSAAAKAKRTNKGLNITIYEKTNTTSFGACGLPYFIGGFFDEPNNMIARTPEEFAQNGISVFTEHEVI
    KVDIKNNTLKVKNLKTQQIFNDTYDKLMIATGGNPIIPPISNIQLNNFYTLRNMKDGQEIRELFKKKDIKNIVIIGAGYI
    GIEMIEAAKTLDKNIRIIQLDKRILTESFDKEITNIMEEELIKNNVLLHTDEFAKSLIGKEKVEGIITNKSEYKADLVIL
    STGIKPATEFLEGQLETLKNGAIIINEYGETSAENIFSAGDCATVYNIISKKNDYIPLATTANKLGKVIGENLAGRRVPF
    KGTLGSASIKVLSLEAARTGLTEEAALRLGIKYKTIFIKDKNHTNYYPNQEDLYIKLIYNKETKEIIGAQIIGKNGAATR
    MHALSLAVYSKLTTNELGMMDFAYSPPFSKTWDALNIAGNAAK