Borrelia garinii PBi uid58125

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|51598322|ref|YP_072510.1| thioredoxin [Borrelia garinii PBi]
    MAVSLTKEDFVAKVFDYKNNKEWSFIGKRPAIIDFYADWCGPCKMLSPIFEKFSKKYENRIDFYKVDTDKEQDVVSVLGV
    KSLPTILFIPVDGKPKVSVGFLQEDAFENIIKDFFGF

    >gi|51598769|ref|YP_072957.1| thioredoxin reductase [Borrelia garinii PBi]
    MLEFETINVNLTKKENLSQKEIEFIEDVIILGSGPAGLTAGIYSVMSNYKVTILEGPEPGGQLTTTTEVYNYPGFKNGIS
    GRDLMLNMREQVVNLGAKTFPETVFSIKRENSIFYLYTENYIYKSKAVIIAVGSKPKKLETLKNSDLFWNKGISV
    CAICD
    GHLFKGKRVAVIGGGNTALSESIYLSKLVDKVYIIVRKDYLRAIAMLRDSVAKLPNIEIFYNSEAIEVDGESSVSSIKIF
    NEKDNVVNKLKVNGVFMAVGYKPNTEFLKGFLDLDEEGFIITKDIVKTSVDGVFSCGDVSNKLYAQAITAAAEGFIASVE
    LGNFLK

    >gi|51598980|ref|YP_073168.1| coenzyme A disulfide reductase [Borrelia garinii PBi]
    MKIIIIGGTSAGTSAAAKAKRLNKKLDITIYEKTNIVSFGTCGLPYFIGGFFDNPNKMISRTPEEFEKTGISVKTNHEVI
    KVNVKNNTIVIKNQITGSIFNNTYDKLMIATGAKPIIPAINNINLKNFYTLRNLEDGQKIKNLMDKEEIKNIVIIGAGYI
    GIEMIEAVKNKRKNVRLIQLDKHILIDSFDEEIVKIMEEELIQKGVDLHTSEFVKSLIGGKKVEGVVTNKNTYQADVVIL
    ATGIKPATEFLENQLKTSTNGAIIVNEYGETSIKNIFSAGDCATIYNIVSKKNEYIPLATTANKLGRIVGENLAGNHVSF
    KGTLGSASIKILSLEAARTGLTEKDAKKLQIKYKTIFIKDKNHTNYYPGQEDLYVKLIYEENTKIILGAQAIGKNGAVIR
    IHALSIAIYSKLTTKELGMMDFSYSPPFSRTWDILNIAGNAAK