Borrelia duttonii Ly uid58791

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|203283987|ref|YP_002221727.1| thioredoxin [Borrelia duttonii Ly]
    MAISLTKQEFIDKVFDYKNNQEWNFKGIKPAIIDFYADWCGPCKMLAPIYDELSEEYGDKIDFYKVNTDKEQEVSMVLGV
    QSLPTIIFVPVGDKPRVSVGFIEKNSLKDAIKDLFKV

    >gi|203284424|ref|YP_002222164.1| thioredoxin reductase [Borrelia duttonii Ly]
    MLNFEVLDIKKCNREIIRTEVDFVEDVIIVGSGPAGLTAGIYTVMSGYKTSILEGPEPGGQLTTTTEVYNYPGFKNGING
    RELMLNMKEQAINLGATTYFETVRSIKKRGDIFCLYTDNYIYKSKSIVIAAGSIPKKLDTLKNLDLFWNRGISV
    CAICDG
    HLFKGKTLAVIGGGNTAISEAIYLSKLAEKVYVIVRKNYMKAIDMLQKSIKTLSNVNILYNCEAREVSGENIVSKIHIMD
    NKHNSAFELNVDGIFIAIGYKPNTEFVKGFLKLDDDGYISTQDIVKTSVNGVFSCGDVSNKLYAQAITAAAEGFLASVEV
    RNFLG

    >gi|203284623|ref|YP_002222363.1| NADH oxidase, water-forming [Borrelia duttonii Ly]
    MKIIIIGGTAAGTSAAAKAKRINKELNIVIYEKTNTTSFGACGLPYFIGKFFDEPNNMIARTPEQFKQNGISVFPKHEVT
    KVDIKNNILQVKNLQTQEIFNDTYDKLMIATGGTPIIPPINNIKLKNFYTLRNMKDGKEIRELLNKQEIKNIIIIGAGYI
    GIEMVEATKAREKNVRIIQLDKRILTESFDKEITNIMEEELIKNNVLLHTNEFVTSLIGKDKVEGIITNKSEYKADLVIL
    STGIKPATEFLEGQLDTLKNGAIIVNEYGETSAKNIFAAGDCATIYNIISNQNDYIPLATTANKLGKIIGENLAGKRVSF
    KGTLGSASIKVLSLEAARSGLTEEMALKLGIQYKTVFIKDKNHTNYYPNQEDLYIKLIYNQDTKEILGAQIIGKNGAALR
    MHALSLAIYSKLKINELGMMDFAYSPPFSKTWDALNIAGNAAK