Borrelia burgdorferi ZS7 uid59429

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218249815|ref|YP_002374592.1| thioredoxin [Borrelia burgdorferi ZS7]
    MAISLTEEDFVVKVFDYKNNKEWSFRGDRPAIIDFYANWCGPCKMLSPIFEKLSKKYENSIDFYKVDTDKEQDISSAIGV
    QSLPTILFIPIDGKPKVSVGFLQEDAFENIIKDFFGF

    >gi|218249914|ref|YP_002375024.1| thioredoxin-disulfide reductase [Borrelia burgdorferi ZS7]
    MLEFETIDINLTKKKNLSQKEVDFIEDVIIVGSGPAGLTAGIYSVMSNYKAAILEGPEPGGQLTTTTEVYNYPGFKNGIS
    GRNLMLNMREQVVNLGAKTFPETVFSIKRKGNIFYLYTENYIYKSKAVIIAVGSKPKKLETLKNSGLFWNKGISV
    CAICD
    GHLFKGKRVAVIGGGNTALSESIYLSKLVDKVYLIVRKDNLRAIAMLRDSVAKLPNIEILYNSEAIEVDGKSSVSSVKIF
    NKKDNVVYELEVSAVFMAVGYKPNTEFLKGFLDLDEEGFIVTKDVVKTSVDGVFSCGDVSNKLYAQAITAAAEGFIASVE
    LGNFLK

    >gi|218249475|ref|YP_002375226.1| CoA-disulfide reductase [Borrelia burgdorferi ZS7]
    MKIIIIGGTSAGTSAAAKANRLNKKLDITIYEKTNIVSFGTCGLPYFVGGFFDNPNTMISRTQEEFEKTGISVKTNHEVI
    KVDAKNNTIVIKNQKTGTIFNNTYDQLMIATGAKPIIPPINNINLENFHTLKNLEDGQKIKKLMDREEIKNIVIIGGGYI
    GIEMVEAAKNKRKNVRLIQLDKHILIDSFDEEIVTIMEEELTKKGVNLHTNEFVKSLIGEKKAEGVVTNKNTYQADAVIL
    ATGIKPDTEFLENQLKTTENGAIIVNEYGETSIKNIFSAGDCATIYNIVSKKNEYIPLATTANKLGRIVGENLAGNHTAF
    KGTLSSASIKILSLEAARTGLTEKDAKKLQIKYKTIFVKDKNHTNYYPGQEDLYIKLIYEENTKIILGAQAIGKNGAVIR
    IHALSIAIYSKLTTKELGMMDFSYSPPFSRTWDILNIAGNAAK