Borrelia burgdorferi B31 uid57581

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15594407|ref|NP_212195.1| thioredoxin (trxA) [Borrelia burgdorferi B31]
    MAISLTEEDFVVKVFDYKNDKEWSFRGDRPAIIDFYANWCGPCKMLSPIFEKLSKKYENSIDFYKVDTDKEQDISSAIGV
    QSLPTILFIPVDGKPKVSVGFLQEDAFENIIKDFFGF

    >gi|15594860|ref|NP_212649.1| thioredoxin reductase (trxB) [Borrelia burgdorferi B31]
    MLEFETIDINLTKKKNLSQKEVDFIEDVIIVGSGPAGLTAGIYSVMSNYKAAILEGPEPGGQLTTTTEVYNYPGFKNGIS
    GRNLMLNMREQVVNLGAKTFPETVFSIKRKGNIFYLYTENYIYKSKAVIIAVGSKPKKLETLKNSGLFWNKGISV
    CAICD
    GHLFKGKRVAVIGGGNTALSESIYLSKLVDKVYLIVRKNNLRAIAMLRDSVAKLPNIEILYNSEAIEVDGKSSVSSVKIF
    NKKDNVVYELEVSAVFMAVGYKPNTEFLKGFLDLDEEGFIVTKDVVKTSVDGVFSCGDVSNKLYAQAITAAAEGFIASVE
    LGNFLK

    >gi|15595073|ref|NP_212862.1| coenzyme A disulfide reductase [Borrelia burgdorferi B31]
    MMKIIIIGGTSAGTSAAAKANRLNKKLDITIYEKTNIVSFGTCGLPYFVGGFFDNPNTMISRTQEEFEKTGISVKTNHEV
    IKVDAKNNTIVIKNQKTGTIFNNTYDQLMIATGAKPIIPPINNINLENFHTLKNLEDGQKIKKLMDREEIKNIVIIGGGY
    IGIEMVEAAKNKRKNVRLIQLDKHILIDSFDEEIVTIMEEELTKKGVNLHTNEFVKSLIGEKKAEGVVTNKNTYQADAVI
    LATGIKPDTEFLENQLKTTKNGAIIVNEYGETSIKNIFSAGDCATIYNIVSKKNEYIPLATTANKLGRIVGENLAGNHTA
    FKGTLGSASIKILSLEAARTGLTEKDAKKLQIKYKTIFVKDKNHTNYYPGQEDLYIKLIYEENTKIILGAQAIGKNGAVI
    RIHALSIAIYSKLTTKELGMMDFSYSPPFSRTWDILNIAGNAAK