Borrelia afzelii PKo uid58653

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|111114882|ref|YP_709500.1| thioredoxin [Borrelia afzelii PKo]
    MAISLTKEDFVVKVFDYKNNKEWSFKGEGPAIIDFYADWCGPCRMLSPIFEKLSKKYENSIDFYKVDTDKEQDIASVLGV
    KSLPTILFIPIDGKPKVSVGFLQEDAFENIIKDFFGF

    >gi|111115343|ref|YP_709961.1| thioredoxin reductase [Borrelia afzelii PKo]
    MLEFETIDINLTQKENLSQKEVDFIEDVIIVGSGPAGLTAGIYSVMSNYKATILEGPEPGGQLTTTTEVYNYPGFKNGIS
    GRDLMLNMREQVVNLGAKTFLETVFSIKKRNSIFYLYTENYVYKSKAVIIAVGSKPKKLESLKNSDLFWNKGISV
    CAICD
    GHLYKGKRVAVIGGGNTALSEAIYLSKLADKVYVLVRKDYLRAIAMLRDNVAKLPNIEILYNSEATEVDGKSSISSVKIF
    NKKDNIVYKLEVNAVFMAVGYKPNTEFLKGFLDLDEEGFIITKDVVKTSVDGVFSCGDVSNKLYAQAITAAAEGFIASVE
    LGNFLK

    >gi|111115558|ref|YP_710176.1| coenzyme A disulfide reductase [Borrelia afzelii PKo]
    MKIIIIGGTSAGTSAAAKAKRLNKSLDITIYEKTNIVSFGTCGLPYFIGGFFDNPNTMISRTQEEFEKTGISAKTNHEVI
    KVDTKSNTIVIKNQKTGSIFNNNYDKLMIATGAKPIIPAITNINLKNFYTLRNLEDGQNLKNLMDKEEIKNIVIIGAGYI
    GIEMIEAAKNKRKNVRLIQLDKHILTDSFDEEIVKIMEEELIEKGVELHTSEFVKSLIGEKRVEGVVTNKNTYQADVVIL
    ATGIKPDTEFLENQLKTTTNGAIIVNEYGETSIKNIFSAGDCATIYNIVSKKNEYIPLATTANKLGRVVGENLAGNHVPF
    KGTLGSASIKILSLEAARTGLTEKDAKKLQINYKTIFVKDKNHTNYYPGQEDLYVKLIYEENTKIILGAQAIGKNGAVIR
    IHALSIAIYSKLTTKELGMMDFSYSPPFSRTWDILNIAGNAAK