Bordetella petrii

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|163854371|ref|YP_001628669.1| thiol:disulfide interchange protein DsbA precursor [Bordetella petrii DSM 12804]
    MQSSLFTRLVAAAALAASTLFAPASQAQGAQQYVAINPPLPSDTPGKIEVLEFFAYTCPHCATMEPLVEAWAKTAPSDVV
    VKQVPVAFNASMKPLQQLYYTLQTLNRPDLHSKVFTAMHVEHKRLFNKKAMGDWAAEQGVDRAKFDSIFDSFSVQTQVQR
    ADQLAQAYNIDGTPSFGVGGKFLTSPALAGNSYEGALKEVDRLIPLARQ

    >gi|163854423|ref|YP_001628721.1| stringent starvation protein A [Bordetella petrii DSM 12804]
    MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMNPYGQVPILVERDLVLYESNIINEYIDERFPHPQLM
    PADPVMRARTRLFLYNFEKELFVHVSTLEDRSAKPDEKKLATARQNIRDRLAQLAPLLLKNKYMLGDEFSMLDVAVAPLL
    WRLDHYGIELPKNAAPLQKYAERIFSRPAYIEALTPSEKVMRR

    >gi|163854631|ref|YP_001628929.1| putative thiol:disulphide interchange protein (periplasmic) [Bordetella petrii DSM 12804]
    MNSRFPALLARALCAAGLILASGAWAGQDPATKDQVYSTVPGASAPAGKSYSTESVSDPVAQAVKERFAQRFSELSVTAV
    RRTPYGIFEVQLGGDLVYTDEKVTWVMEGPLIDAMTRRDVTRERQEKLGSVAFDELPLDLAVKLVRGDGSRKIAIFEDPN
    CGYCKQLHKTLQNEDNLTIYTFLFPILAPDSKTKSRDVWCAKNPAQAWEDWMLRGKTPATAECEAPIQQVLALGQKLMVR
    GTPAIFFQDGTRLNGAAPLEMIQARLGK

    >gi|163854688|ref|YP_001628986.1| hypothetical protein Bpet0383 [Bordetella petrii DSM 12804]
    MHDIQTLLALYGGWLVFLNVLVEQAGLPVPAYPMLIAAGALAGGTGGWLLVCLVAALACVLADTAWYVAGRRYGGRLLEL
    VCKVSLSQDSCIRQTQKLYLRVGVRSLLVCKFMPGAGALSTAMAGLTGTPYRRFLAYDLAGSLIWVSSALLLGALFRDVV
    GDVLALLNTYGPLGLALLAFVLLVYVLTRGLRRWVLVRRLRRIPRLHPEELLRWQAAGRAPIVLDVRPGIDATLPRIPGA
    IAVDLAAPLTDLPLAGQAGEIVVYCA
    CPNEISAARLAARLRAAGYSGIWALQGGYDAWARMAHETPDLSVPK

    >gi|163854741|ref|YP_001629039.1| thioredoxin [Bordetella petrii DSM 12804]
    MKKLILTLAVVVAAGIGAWFVWRPAPPAPDVAFTTIEGKTFSMHDLRGKVVLVKFWATSCVTCVKQMPGAIDTYNEYAPK
    GYETVAVAMSYDPPNYVLNFAETRKLPFPVALDVKGELARSFGDVKLTPTAFLIDKQGRIIKRYLGEYDPAEFHAAIEKA
    LAAG

    >gi|163854746|ref|YP_001629044.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella petrii DSM 12804]
    MKRLAANEAVAYLDTDTPLGGLRLAASDDALRGAWFLDQWDLPPPSPAWRLAPGHPVLGQARDELAQWFAGQRREFEVAL
    DPQGTAFQQAVWQALLRLPFGATCSYGDLAQSIGRPKSVRAAAQAIGRNPISIFIP
    CHRVIGRDTSLTGFGGGLARKQAL
    LSHEGHRYPGRGARTRRVDDGQAELPW

    >gi|163854877|ref|YP_001629175.1| thioredoxin [Bordetella petrii DSM 12804]
    MNRRIFLYAGAAVAVAAAGGYAYRQRGGQAAHTPAPAPAGDPVAALQALSLPDLDGQPHSLSQWRGRPMVVNFWATWCAP
    CVKEMPELQALHQKYPAIQFVGIGVDKAENMRQFLQKVPVSYPLLVMGAGAVDTLRTLGNPAGGLPFTLVFDANGRINRK
    ILGQIQSDDLDRTLQDLAA

    >gi|163854902|ref|YP_001629200.1| iron-sulfur cluster insertion protein ErpA [Bordetella petrii DSM 12804]
    MNAVTETVDLQAPPSPLIFTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFDEAVNEDDTVLDKNGVQLLVD
    PMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV

    >gi|163854932|ref|YP_001629230.1| hypothetical protein Bpet0627 [Bordetella petrii DSM 12804]
    MTIRVRQNAPGTLQFTATAEGHELPLDMPRPQGQGPDPHDYFDTSLGGCKAMTVMLYAQRKEIPLESVDVDVVRDAGEER
    KGIYRLTAKLTLHGPLSDAQIDELFSVAEK
    CPVHKLMTAVDVQVSTLVVRPA

    >gi|163855230|ref|YP_001629528.1| putative thioredoxin-like protein [Bordetella petrii DSM 12804]
    MPLLVPGPDTPALRAALADGGPDTWLVACFCAAWCDTCGQYRPRLAALAEAQPQRVFAWIDIEDHPDLLGDEDVENFPTL
    LVQVGGRVVFYGPMLPHIGHLERLLDSLAPDSPTVATGLPDVPALLAQ

    >gi|163855327|ref|YP_001629625.1| arsenate reductase [Bordetella petrii DSM 12804]
    MRPEPYPQITKTFLMSNITIYHNPACGTSRNVLALIRNSGEEPTVIEYLKTPPDSETLQHLIADMGVPVRAVLREKGTPY
    AELGLDDPKWSDEQLIDFMLQHPILINRPIVVTPLGTRLCRPSETVLDILPQPQRGAFNKEDGKAVVDAQGRRV

    >gi|163855671|ref|YP_001629969.1| hypothetical protein Bpet1364 [Bordetella petrii DSM 12804]
    MQSSLFSRFPRFPLRRMVGPLVALTLTVLLLAAWYLASPSGSPAKTGAENAASQQLQAGPPWRYGRADARFTLVLYADLE
    CPYCKSYYPLLKAWVDRNPETNLQWHHLPLSMHEPAATRQARLAECAGEAGGHAAFWQAVTWIYQQTRSDGAGIPDNVRY
    PALTPAMQTCLDSTRTEAIIQAQANEGSRDGVTATPTLKLSDNQSGRTLVLPGPLEGDALLSALDLLSADGDTDQGMNVE
    TPADAVSSVPR

    >gi|163855827|ref|YP_001630125.1| glutathione reductase [Bordetella petrii DSM 12804]
    MVRATCRAAQAAAPAGVVRAHGETAWVPHPCHGRPVMKEVDLFVIGGGSGGVRAARIAAGHGARVALAESSRIGGTCVIR
    GCVPKKLMVLASRCSQEIDVATAFGWTVGERRFDWERLRSNIAAEVSRLEAAYTNGLLQAGVSVLYDRATLEDRGVVRLA
    GSGEAIRARRILIATGARPSTAEELPGAELASDSDAFFEWHLQPARVLVQGAGYIALELGCLLQRLGSQVTLVMRGTTVL
    RGFDNGLREHLQQALFETGMAIVPRCTVTGLTRHADGSIQAKLSDGSSAAFDAVLRATGRQPNTRELNLEQVGVATTASG
    AIVVDEWSQTSVAGVYAIGDVTARALLTPAAVREGHALADTLFGGRKVPVAHDLIPTAVFTTPEAATVGLGEEGAAARFG
    AIDVYEARFKPMKHAMSAQPGHMLIKVIVDRASDRVLGVHIVGPEAAEMIQLAGIALQMGATKAQFDAVLPVHPTAAEEI
    VTLRAPTRRHG

    >gi|163855866|ref|YP_001630164.1| putative thioredoxin [Bordetella petrii DSM 12804]
    MSGSTSFDPSQVFDVFAMCPVGSADFDQAVVEAPGDDLRCVFLWGQNCYNCNLFKQAALLHRQALLDLGLTWFQADVYAD
    EALGRRFSLHGVPTFVLYRGGRRLGRITGWPGLPRFTEAIGRLLKNPSGDPS

    >gi|163855883|ref|YP_001630181.1| hypothetical protein Bpet1573 [Bordetella petrii DSM 12804]
    MPTPKHAKVLILGSGPAGYTAAVYAARANLAPVLVTGLAQGGQLMTTTDVDNWPADATGVQGPDLMQRFQQHAERFNTDI
    VFDHIAKVDLSQRPFTLTGDTGNVYTCDALIIATGASAKYLGLPSEEAFMGRGVSG
    CATCDGFFYKNQDVVVVGGGNTAV
    EEALYLSNICRKVTLIHRRDKFRAEPILVDKLMDKVENGNMELKLFHTLDEVLGDDSGVTGVRVRHTDTGATEDLPVTGA
    FIAIGHQPNTGIFEGQLDMKDGYIVTKSGLSGMATMTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRWLENAQ

    >gi|163855941|ref|YP_001630239.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bordetella petrii DSM 12804]
    MNKVKIDFVSDVACPWCAVGLGGLLAAIERIGPEAEFEIHMQPFELNPDMPKGGQNTGERLMKKYGFDKPRLQENRRVIA
    ERAAAVGMLMHQTDDSRSYNTFDAHRLLHWAGTLGQAQQVALKRSLLKTYHFDNLDTSESDVLAQAARDAGLDAEAAREV
    VASGRYADEVRADQEKWRNLGISSVPSVIINDKYLVSGGQPPEVFEQALRQVASGG

    >gi|163856008|ref|YP_001630306.1| alkyl hydroperoxide reductase [Bordetella petrii DSM 12804]
    MKTVGDKLEPFKVTGVKPGFNQHEENGVSAFEDITESSFPGKWKVIYFYPKDFTFVCPTEIVGFNKLAKDFEDRDAVLLG
    GSVDNEFVKLAWRREHPDLNKLGHYQFGDTTGSLVDQLGVRDKNEGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLR
    LLDGLQTDELCPCNRTVGGATL

    >gi|163856021|ref|YP_001630318.1| methionine sulfoxide reductase B [Bordetella petrii DSM 12804]
    MGRDYARTISRSGTPTVHMEKVRKTDAEWRAQLTPEEYAVARQKGTERPFTGRYWNTTTHGIYRCVGCGTPLFASDTKFD
    AGCGWPSYFEPLDPARVREETDTSHGMVRTEVLCNICDAHLGHVFPDGPEPTGLRY
    CINSLSLKFEPLED

    >gi|163856144|ref|YP_001630442.1| dihydrolipoamide dehydrogenase [Bordetella petrii DSM 12804]
    MSKQFDVVVIGAGPGGYIAAIRAAQLGMSVACIDAWQNGQGGPAPGGTCTNVGCIPSKALLQSSEHFEQANHHFAEHGIE
    VKGVSLKLDTLIGRKNTVVKQNNDGILYLFKKNKVTFFHGKGAFAGKADGGYAIKVTGTAEEDLVAKHVVVATGSSAREL
    PGLPFDEKVVLSNDGALNIDGVPKKLGVIGAGVIGLEMGSVWRRLGAEVTILEAMPEFLAAADQQVAKEALKAFTKQGLD
    IQMGVKIGEIKATAKQVTVPYTDAKGGEQKLVVDKLIVSIGRVPYTGGLNAEGVGLKLDQRGFIEVDGDCKTNLPNVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFDTVPWVIYTSPEIAWVGKTEQQLKKEGREYKAGSFPFLANGRARALG
    DTTGFAKVIADAKTDEVLGVHIVGPMASELISEAVTIMEFRGAAEDIARICHAHPTLSEAVKEAALAVDKRALNF

    >gi|163856185|ref|YP_001630483.1| methionine sulfoxide reductase A [Bordetella petrii DSM 12804]
    MTTERAVLAGGCFWGMQDLIRKLPGVISTRVGYTGGDVPNATYRNHGTHAEAIEILFDPSQISYRRLLEFFFQIHDPTTP
    NRQGNDRGMSYRSAIYFTSEQQKAVALDTIADVNASGLWPGKVVTEVEPAGDFWQAEPEHQDYLERFPDGYTCHFARPDW
    VLPRRADTGTNGA

    >gi|163856186|ref|YP_001630484.1| methionine sulfoxide reductase B [Bordetella petrii DSM 12804]
    MATSYKRTEAAIASLTPEQYRVTQESGTERPGTGALLHNAEPGIYVDVVSGEPLFSSTDKYESGCGWPSFTKPVEPVNIN
    ERRDASHGMIRTEVRSTHGDSHLGHVFPDGPRDRGGLRY
    CINSASLRFVPRDQMVEQGYGEYLDQVKEIS

    >gi|163856213|ref|YP_001630511.1| antioxidant protein [Bordetella petrii DSM 12804]
    MSQLRLGDTAPDFEQKSSIGPIRFHEYLGDSWGVLFSHPADFTPVCTTELGYTAKLADEFAKRNVKVLALSVDGVESHTK
    WIDDINDTQSTKVNFPIIADDDRKVAELYDMIHPNASATVTVRSVFIVDPAKKVRLIITYPASTGRNFNEILRVIDSLQL
    TDSHSVATPVNWEDGDDVIIVPSLQDEAVLKQKFPKGYKAVRPYLRITPQPNK

    >gi|163856262|ref|YP_001630560.1| hypothetical protein Bpet1952 [Bordetella petrii DSM 12804]
    MKSQATLYGLSKCSTCVKARDWLSAHNVAHEFIDYRDHPVPAATLKAWAAQVGGWEKLVNRTSMTWRSLSDDRKAAQTDA
    DWTRLIADYPALVRRPVTVTPDGEVTVGFSEKRYGERFA

    >gi|163856282|ref|YP_001630580.1| thioredoxin [Bordetella petrii DSM 12804]
    MTSLAASGCRDGICRRRPVGRAATSYTKPANPVVINSGMLNSLPFSRTTNGRAAGASHAAEPRITMSEQIKNVSDASFDA
    DVIKSSQPVLVDYWAAW
    CGPCKMIAPILEEVASEYSGRLTVAKLNVDENQGTAAKYGIRGIPTLMLFKDGQAAATKVGAL
    SKSQLTAFLDGAL

    >gi|163856476|ref|YP_001630774.1| disulfide bond formation protein B [Bordetella petrii DSM 12804]
    MFSSRQRLLLLIAVLCFAAVGLALVSQHVFDMPPCAWCVLQRLIYLAIGVVALAGAFAGAIARVCAALCALLGVGGIAAA
    WYQYDVAAQMFS
    CSQTFADRFMSGSGLDGAVPWLFGIFASCMDASVDLLGLEYALWSLALFVVLVIAALRALLRR

    >gi|163856782|ref|YP_001631080.1| methionine sulfoxide reductase [Bordetella petrii DSM 12804]
    MKTTRRLFLAVGGGGLLAGMLGALAGPGGQARAAQETYAVMHSDAEWRTLLTPAQYAVLRQADTERPYSSPLDHEHRDGT
    YACAGCAQPLFSSQTKFDSGTGWPSFWQPLPHAVGTTRDRSFGMVRTAVHCSRCGGHLGHVFDDGPRPTGLRY
    CMNGVAL
    AFSPAAS

    >gi|163856783|ref|YP_001631081.1| hypothetical protein Bpet2471 [Bordetella petrii DSM 12804]
    MNSTRATPAAKSGFLSRRASFRLAGAALLAGAAWFTFQTPGRAAEAVYRIPPPAMDLPAGDAHTATAVLAGGCFWGVQAV
    FQHVQGVTQALSGYAGGNAGSANYDTVSSGRTGHAEAVQITYDPTRVSYGQLLQIYFSVAHDPTQHNRQGPDVGTQYRSA
    IFPASDDQRKVAEAYIAQLNRSGIYPKPLATTVENLQGFYPAENYHQDYLAHHPDSLYIVINDQPKIENLAKEYPARFRQ
    TPVLVGG

    >gi|163856793|ref|YP_001631091.1| bacterioferritin comigratory protein [Bordetella petrii DSM 12804]
    MKHALAMLALAAALGGPLAARAELPVGAPAPDFSAPASLGGQVYTFKLAQALAQGPVVLYFYPAAFTQGCTIEARNFAEA
    TDDYQALGAKVIGVSADDIDTLKKFSVSECRSKFAVAADGDQSIMKAYDAVHDRRPEYAKRVSYVITPDGKILYAYTDMS
    PDHHVANTLQALRQWRATQPGAGQ

    >gi|163856794|ref|YP_001631092.1| arsenate reductase [Bordetella petrii DSM 12804]
    MSATIYHNPRCSTSRNVLQMIRDAGIEPTVIEYLKSPPSRQTLAGLIQQSGLSVREAVRAKEPVYQELGLDAAGVSDDEL
    LDAMVENPILINRPFVVTEQGARLCRPTERVLEILPGATR

    >gi|163856797|ref|YP_001631095.1| hypothetical protein Bpet2485 [Bordetella petrii DSM 12804]
    MSTIYDFSALDLNGEEQALDAFRGRVLLVVNVASQCGFTPQYAGLEALYRDYHAAGLSVLGFPCDQFGHQEPGDEAAIRD
    FCTTQYGVTFPMFAKIEVNGPDAHPLYRWLKGEKPGVLGTEAIKWNFTKFLVGRDGQVIKRYAPTDKPSALKDDILRACE
    ADT

    >gi|163856850|ref|YP_001631148.1| dihydrolipoamide dehydrogenase [Bordetella petrii DSM 12804]
    MPAHFLPYGLLCRRGHAALVQHGTVMDILHTDIAVIGAGTAGLAAYRAARAAGKRALLIEGGPYGTTCARVGCMPSKLLI
    AAAEAAHSAAHTAPFGVHIDGAVRVDGRAVMERVRRERDRFVGFVLEGVENIPAEDKLAGYARFVSDTVLRVDERVEVRA
    ASVVIATGSRPSVPPPFLALGDRLVVNDDVFAWQDLPRSVAVFGPGVIGLELGQALARLGVRVRVFGVSGSLGGLGDPVV
    RQRARRSFQDEFYLDPDARVLSTTRVGDQVEVRYVALDNTERTELFDYALVATGRRPNVDGLDLHHTSLARDARGVPEFN
    RNTLQAGAAPIFIAGDANADAPLLHEAADEGRIAGANAARYPDVQPGLRRAGLAVVFSDPQIAMVGTPYARLPQGGFVTG
    EVDFGDQGRSRVMLKNKGILHVYADNETGQFLGAEMVGPAAEHIGHLLAWAAQQQLTVARMLDMPFYHPVVEEGLRTALR
    DAAARLQEVRQAQRQAA

    >gi|163856851|ref|YP_001631149.1| putative glutaredoxin [Bordetella petrii DSM 12804]
    MLQNREGQRVPNVTFPIRQDNEWKQVSTDDLFKNKTVVVFSLPGAFTPTCSSTHLPRYNELASTFASVGVDAVVCVSVND
    TFVMNEWAKDQEAGNITLLPDGNGDFTEGMGMLVDKRDLGFGKRSWRYSMLVKDGVIEKMFIEPQKEGDPFEVSDADTML
    AYIAPQAKKPDQVVVFSKPG
    CPFCIEAKALLADKGYDPIEIPLEHKVRGRVIGAISGKGTAPQVFINGTLVGGLEDLKAY
    L

    >gi|163856866|ref|YP_001631164.1| thioredoxin [Bordetella petrii DSM 12804]
    MSSIVELTKDSFQEAITPDNTLIVDFWAPWCGPCRGFAPVFEQAAEQNPDVTFAKVNTDVEQELAGALGIRSIPTLMVFR
    EQVLLFSQPGALSAGQLDELLEKIKAVDMAKVHQEIAAAQDGSEK

    >gi|163857008|ref|YP_001631306.1| hypothetical protein Bpet2696 [Bordetella petrii DSM 12804]
    MYCTQCQWLLRAAWMAQELLSTFGTDLGAVALVPGTGGVFRIHYDDSLLWDRTVDGGFPDAKVLKQRVRDHLDPGRDLGH
    IDRSGRAGD

    >gi|163857062|ref|YP_001631360.1| bacterioferritin comigratory protein [Bordetella petrii DSM 12804]
    MTPHIGKPAPQFIAESTIGPISLEQCRGRAVVLYFYPKDNTPGCTTESQDFRDLHADFLAAGAVVVGISRDSLKSHQNFQ
    NKYQLPFPLISDTDETVCNLYGVIKQKNMYGKQVRGIERSTFLVDAEGRLVQEWRGVKVPNHASEVLQAARSIG

    >gi|163857087|ref|YP_001631385.1| hypothetical protein Bpet2775 [Bordetella petrii DSM 12804]
    MSVTLTQQAASHIGRYLQKRGKGVGLRLGVRTTGCSGMAYKLEYVDDPAPEDMVFESFGVKVFVDPKSFAYLDGTELDYA
    REGLNEGFKFRNPNEKATCGCGESFTV

    >gi|163857203|ref|YP_001631501.1| hypothetical protein Bpet2891 [Bordetella petrii DSM 12804]
    MTRFPLAALLAAFFLALAWFVSLRQAVLFLVGIGMGAVLAGARFGFTTGWRRLIEQRDPSGVMAQLVLLAVAAAVCMPLL
    AAFPTDLGAALGPPSISLLVGAFVFGAAMQVADG
    CGSGTLYKAGMGVPLNMTILPIFAIGSFLGSAQLEQWLQLGATRPV
    SLVATFGPWEAFGMTCAGLLLLGLAARAWVGKGASWFNRRLFIGAILLAALAMLNLVIAGQPWGVVYGFGLWAAKVATAA
    GVFDPAANAFWSQPVNLHNLSQSVFLDVTSITNIGILAGALLVAAGNSSATQRAPLTGQQWVVGIVAGFLLGYSSRLAFG
    CNIGAMVSGISTGSLHGWIWVPVAFCGSLIGVRIRRHYAF

    >gi|163857204|ref|YP_001631502.1| putative thiosulfate sulfurtransferase [Bordetella petrii DSM 12804]
    MKRISLMFAAAAITAGASFGAQAAAPLLTPAELNEARADSAVRIIDIRPPQEYAANHIPGAVSAPYAQWRGPADNPGQLP
    PVDKLAELVRSLGVDKSVHAVVVSSGANDTDFGSSARVYWTLKYLGLSELSILNGGVKAWVDAGLPQDQAVPSVAASSYT
    PVLDRSLIATQDHVLAQIDNPKVHLVDARPSNFFRGEVKAPTAKVPGTIHNALNLEHSKWFKPGTAIFVSPEEAKAIAAQ
    SLPEPADETISF
    CNTGHWAATDWFALSEVVGQKNVMLYPASLADWTQSSKELPMDNVPSRGQQILKSLKDLVS

    >gi|163857230|ref|YP_001631528.1| hypothetical protein Bpet2918 [Bordetella petrii DSM 12804]
    MQQIDLTDSTADRYLLDAPGLSLLAFHSRTCATCKIAREQLPQLDLPVERLCWVDAGDNGGLVARYEVFHLPALFLVRDG
    AFYGPVNASLAEWDLRQQIGLALDSYPAELP

    >gi|163857235|ref|YP_001631533.1| glutathione reductase [Bordetella petrii DSM 12804]
    MAFDFDLYVIGAGSGGVRAARFAAGYGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHYREDLEHAASYGWTTGQPSFDW
    ATLIANKNREIERLNGIYRNLLTGSGVTLHEGHARLLDPHTVEINGQRHTARHILVATGGWPNVPDIPGKEHAITSNEAF
    FLKALPRRVLVVGGGYIAVEFASIFNGMGAQTVQVYRRDLFLRGFDGSVREHLRDELIKKGLDLRFNADVARIDKRPDGS
    LAATLKSGEVVETDCVFYATGRRPMLDNLGLENTGVKLNDDGFIAVDDEYRSSEPSILALGDVIGRIPLTPVALAEGMAV
    ARRLFRPDEYRKVDYNLIPTAVFSLPNIGTVGLTTEAALQAGHRIKRYESRFRPMKLTLTGDQEKTLMKLVVDADTDRVL
    GCHMVGPDAGEIVQGLAVALKAGATKQVFDETIGIHPTAAEEFVTLRTPVQE

    >gi|163857297|ref|YP_001631595.1| oxidoreductase [Bordetella petrii DSM 12804]
    MDHDVIIIGGSYAGMSAGLQLARARRRVLVVDAGQRRNRYAAHSHGFLTRDGKPPAQIAAEGRAQLMRYETVQWLDDRVD
    QARPVAGGFEVTLRQGGVRTGQRLILAAGVEDELPALPGLEPRWGTHVFH
    CPYCHGYELQQGPVGVLAVSAISLHQALML
    PDWGATTLFLNGAFTPDAEQQAQLRARGVRVEPGRVARLDGAAIDVVMEDGRVFALAGLFVATRVRVGGLAAQLGCELEE
    GPMGPYVKADATRATTAPGVFACGDLARPAGSVALAVGDGAMAGAAAHRSLMFGL

    >gi|163857329|ref|YP_001631627.1| dihydrolipoamide dehydrogenase [Bordetella petrii DSM 12804]
    MSTLVEIKVPDIGDFKEVEVIEVLVSEGDTIQAEQSLITVESDKASMEIPASSGGVVKSVKVKVGDKVAEGKVILQVEAG
    ETKEAKPAPAASQVSDSQRVSDTVTKEKAPQKGQPVNAAAQYSGSADVECDVLVLGAGPGGYSAAFRAADLDLSTVLVER
    YDTLGGV
    CLNVGCIPSKALLHNAAVIDEARALAAHGISFGEPKIDLDKLRGYKDSVVAKLTGGLAGMARARKVKVVTGVG
    EFADPHHLAVKGADGKTQTIRFKNAIIAAGSQSVKLPFLPDDERIVDSTGALQLRAIPKKMLIIGGGIIGLEMGTVYSTL
    GARLDVVEMLDGLMQGADRDLVKVWQKMNAGRFDNIMLKTKTVGAEARKDGIYVSFEGEGAPKEPQRYDLVLQAVGRSPN
    GKKIGADKAGVAVTERGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAEAAAGQKSFFDARVIPAVAYTDPE
    VAWVGLTEDEAKKQGIKVEKGLFPWAASGRAIANGRDEGFTKLLFDAESHRILGGGIVGTHAGDLISEIALAIEMGADMV
    DIGKTIHPHPTLGESVGMAAEVAEGVCTDLPPVRKK

    >gi|163857352|ref|YP_001631650.1| hypothetical protein Bpet3040 [Bordetella petrii DSM 12804]
    MTAATLAQLRVDNSFAALPAAFYTRLAPQPLTAPRLLHANEQAAALIGLSADALRSDEFLRVFSGQQPLPGGQTLAAVYS
    GHQFGVWAGQLGDGRAHLLGEVAGPDGNWELQLKGAGMTPYSRMGDGRAVLRSSVREYLASEAMHGLGIPTTRSLALVVS
    DDPVMRETVETAAIVTRMSPSFVRFGSFEHWSSRRQPDELRILADYVIDKFYPECREPRPGEAPGPDGALLRMLAEVTRR
    TAELMAGWQAVGFCHGVMNTDNMSILGLTLDYGPYGFMDAFRLDHICNHSDSEGRYAWNRQPSVALWNLYRLGGSLHALV
    PDVEALRAVLDSYEVIFTRAFHQRMAAKLGLREWRADDEPLLDDLLRLMHDNRADFTLTFRRLADAVRGRPQGLQDLFID
    RDAALAWFERLAARHAQEGAGNDAQARAAGMDAVNPLYVLRNHLAEQAIRAAKAGDAGEIDTLLALLRDPCVEQPGRDAY
    AALPPDWAGGIEVS
    CSS

    >gi|163857363|ref|YP_001631661.1| antioxidant protein [Bordetella petrii DSM 12804]
    MSKIHLGDTVPDFEQDSSIGTIRFHEWADDSWVVLFSHPADFTPVCTTELGLTGKLQGEFEKRNVKAIALSVDDADSHRA
    WTKDIEDTQNTVVKFPIIADRDKKVAGLYDMIHPNQSGTATVRSVFIIDPDKKLRLTLTYPLSIGRNFDEILRVIDALQV
    SDKYGVATPGNWKNGDDVIIPPALQDEAQIKAKFPQGYRAPRPYLRFTPQPGK

    >gi|163857379|ref|YP_001631677.1| thiosulfate sulfurtransferase [Bordetella petrii DSM 12804]
    MTMTLISAADLAERLQSPGVRIFDVRHDLADHAAGRRAYEQGHIPGARYLDHETELAAPRTGSNGRHPLPARADLAALMA
    GHGVHPDSLVVAYDASGGMFAAHLWWMLRWLGHERVVVLDGGWQGWLAAGHPVDTVTVAAEPLAGAAAPAAPSLVDTVDA
    DAVLANLSRPAFTVLDARAANRYRGEVEPMDPVAGHIPGALNRPNGENLQADGRFKPAAQLRAEFAGLLGERDPRTVVHQ
    CGSGITACHNLLAMEIAGLEGSRLYPGSWSEWCSDPARPVARGA

    >gi|163857499|ref|YP_001631797.1| organic hydroperoxide resistance protein [Bordetella petrii DSM 12804]
    MSLEKVAYRAYAKATGGRDGRAVSSDNVLDVKLTTPRELGGAGGNGTNPEQLFAAGYSACFLGAMKFVANRDKIAIPADV
    SVDGSVGIGPIPNGFGIEVELKISLPGMAREQAEDLVQRAHIV
    CPYSNATRNNIDVTLTVV

    >gi|163857561|ref|YP_001631859.1| hypothetical protein Bpet3249 [Bordetella petrii DSM 12804]
    MTLLSLSPQAAHSLVAQGALLIDIRSAAEYAGERIEQARHIPLDQLAGVRLDASGAAVIFHCRSGHRTQANAAALVACVG
    GEAYVLDGGLAAWKKAGLPTLRTAGPRLDVQRQTMIAAGSLVLLGALLGAAVSPWFYLVPGVVGTGLVLAGLSGFCGLAR
    LLMKMPWNRPAP

    >gi|163857821|ref|YP_001632119.1| dihydrolipoamide dehydrogenase [Bordetella petrii DSM 12804]
    MSETRTTTLLVIGGGPGGYVAAIRAGQLGVSTIVVEGQQPGGTCLNIGCIPSKALIHAAQEYERAREYAGASPLGISVQA
    PAIDIGKTVAWKDGIVARLTGGVEALLKKNGVQLVRGWARVLDGKTVEVDTGQGSQRIQCEHLLLAAGSEPMPLPSMPFA
    GRVISSTEALSPASIPGRLVVVGGGYIGLELGTVYRKLGAEVTVVEAQERILPTYDAELTKPVAAALARMGVQLCLGRKV
    LGMNAAGDAVRVQDASGAETALPADQVLLAIGRRPRTQGWGLENLQLDRAGNALRIDDQCRTSMRNVWAIGDIAGEPMLA
    HRAMAQGEMVAELVAGQRRRFAPAAIPAVCFTDPEIVTAGLAPQQAQAAGLDCVTAAFPFAANGRAMTLESTDGFVRVVA
    RRDNHLVVGWQAVGRGVSELAAAFSQSLEMGARLEDVGGTIHAHPTLGEAVQEAALRALGHALHI

    >gi|163857979|ref|YP_001632277.1| putative AhpC/TSA family protein [Bordetella petrii DSM 12804]
    MTIKVGDRVPDGTLTEFFETESGGCSLGPNNFQVADLVKGKTIAVFAVPGAFTPTCSAKHLPGYVQQAQALKDKGVDEIW
    CVSVNDAFVMGAWGREQQTAGKVRMLADGSAHWTRALGLELDLDARGMGVRSQRYSALLQDGVVKQLNIEAPGKFEVSDA
    ATLLSQI

    >gi|163858037|ref|YP_001632335.1| glutathione reductase [Bordetella petrii DSM 12804]
    MQQDYEFDLFVIGAGSGGVRAARMAAQRNARVGLAEVGALGGTCVNVGCIPKKLYSYAAHYGDAFKESHGFGWDAAPPLL
    DWQRLKSRRAAEILRLNGIYQGLLEGAGVRIVRGRASLYDDHTVQVETEQGGRMFTARHILIATGGTPSVPTLPGSEHAV
    TSDAMFDLDRFPQRLVVVGGGYIACEFASIFNGMGAQVTQLCRGTQLLRGFDDDIREFIADEMGKSGVDVRLGVHVASIA
    KSAGDFEVELADGSDLSADTVLYATGRVPNVSGLGLEAVGIVLRDNGAIVVDADYRTSVPSVYALGDVTGRVQLTPVALG
    EAMAFADQLFGQGRRKMNYDHIPTVVFTHPNIGTVGYGEAQAREMFGEVTVYRSEFRPLKHTLSGRPERAMVKLVVDASD
    RVVGLHMVGPDAGEIVQGFAVAMKAGATKSVFDSTVGVHPTLAEEFVTMREAVTTP

    >gi|163858038|ref|YP_001632336.1| glutathione S-transferase [Bordetella petrii DSM 12804]
    MKQTEEGMLTLFYSPGACSLASHIALAESGLPYQAVRINTKNGDNCTPGYLRINRWGKVPALALEAGEVITEGTAIMTHV
    ADSVPDRVLLPAPGTLDRAKAMEWMAFLASAVHPAFRTMFRAERVAGDSEQAIKNVREHGITALAEALEEAEHRASPSRF
    LVSDAFTLCDSYLTVFFLWSLRVPLKEKLPPIPRCAAVARQVLSRPTVKAVLAVEGIEP

    >gi|163858088|ref|YP_001632386.1| thiol:disulfide interchange protein DsbE [Bordetella petrii DSM 12804]
    MRSRFVWPLIGFIVLVGFLAFGLTLKPSEVPSPLIDKLAPDFTLPRLAAPEHAFSPRSMQGKVWLLNVWASWCYPCLEEH
    PVITDLATTHALPIVGLNYKDIPADAISWLERNGNAFESVVSDQQGAVGIDYGVYGVPETYVIDKEGFIRYKHIGALSYS
    EARDTILPLVRELQK

    >gi|163858173|ref|YP_001632471.1| hypothetical protein Bpet3858 [Bordetella petrii DSM 12804]
    MTQRLNYAEQSPELFKKFVQFSTALHSDTIGQTIGDLIQIRVSQINGCGFCLDMHIKQAKIHGEGELRLHHVAIWRESTL
    FTPRERAALAWAEVLTRLPEGGVPDDIYEHARSEFSEKELTNLTYQVMTINAWNRINIAFRNEPGSADKAFGLDKAGLS

    >gi|163858183|ref|YP_001632481.1| hypothetical protein Bpet3868 [Bordetella petrii DSM 12804]
    MTAHTTGTREAWLAERLALLQAEKELTRRGDELARRRQALPWVRIDKPYRFDTEAGPATLADLFQGRSQLLVYHFMFGPD
    YQAGCPS
    CSSIADGFNGIVTHLANHDVMLTAVSRAPLDKLTAYKQRMGWTFPWASSAGSDFNADFNIWFTETQQRDGDIN
    YNYRRESEFAWRDGQQGGGQTAEDRIAAMCGTDAATFQRDRPGMSAFVREGDAVCHTYSAYARGLDGLWGMYQWLDRAPK
    GRNETGVWWRRHDEYAQR

    >gi|163858202|ref|YP_001632500.1| selenophosphate synthetase [Bordetella petrii DSM 12804]
    MDTPVRLTQYSHGAGCGCKISPKVLDVILAGSGAQNLDPRLWVGNASRDDAAVYGLDDSRGVVSTTDFFMPIVDDPFDFG
    RIAATNAISDIYAMGGDPLLAIAILGWPVNVLPPEVAREVVRGGRAACDAAGIALAGGHSIDAPEPIFGLAVTGVVDKAR
    LKRNDTATAGCKLYLTKPLGIGILTTAEKKSKLRAQDVHLARDWMCTLNKPGSRFGKLEGVKAMTDVTGFGLLGHLVEMA
    DGSGVSARIAFDQVPRLPGIDHYLAEGCVPGGTGRNFDSYGERIAPLGQQQINLLCDPQTSGGLLVAVAPEGEAEFLAAA
    AESGLKLSPIGELIQARRYAVEVV

    >gi|163858267|ref|YP_001632565.1| NADH dehydrogenase [Bordetella petrii DSM 12804]
    MATPHLRPSPIHRVVIVGGGAGGLELAAKLGRRHGPQCVTLVDSRPIHIWKPSLHEAAAGTLDIHQEGLSYLMLANLCGF
    TFALGELRAVDREQRAITLGAVLDSHGDEVLPQRELAYDTLVLAVGSISNFFNTPGAAQHAVTLDNTENAEEFRLTMLKA
    MVQVDQAKVRDPSARLDLVIVGGGATGVELAVELHEAGNTVAAYGLPNFRADRDLAITLVEGAPRILAALPEKISSAALA
    RLTELGIRVETDCRVAEVTPRSVKTADGREFAASLCMWAAGIQGPPLLATLDMPLNRAGQLMVDDHLQSPDPNILALGDC
    CAVPRGNGGTVPARAQAAHQEAGYLARKITARIRGAAEPQAPYQYLDRGSLVSLGQDAGVGSLMGKLAGRGLFVSGTLAR
    LMYMSLHLMHHHAVLGLGRTASMALARLLMRRTHPRVKLH

    >gi|163858351|ref|YP_001632649.1| hypothetical protein Bpet4033 [Bordetella petrii DSM 12804]
    MDCTINWGGPDGMLFVATTGSGHVATMDGAVDGGGHNLAPRPMELLLAGTGGCTAYDVVLILKRGRHAVAGCSVKLSADR
    ADTDPKVFTRIHFAFTVTGKNLPRAAVERAVQLSHEKYCSASAMLEKTAELTFSVDIVDTQETQAA

    >gi|163858389|ref|YP_001632687.1| thiol:disulfide interchange protein DsbE [Bordetella petrii DSM 12804]
    MKKLLRLLPLVLFLGVAALLYRGLFLDPARLPSALVGKPFPEFTLLSLDDARTLTRQDILGTPALVNVWATWCPSCRQEH
    PVLNRLSQSGVVIHGVNYKDDRVSAQRWLSTLHNPYRLNIEDAAGTLGLDLGVYGAPETFLVDARGVIRDKFVGVIDDTV
    WRERLEPVYRQLLDEASR

    >gi|163858460|ref|YP_001632758.1| hypothetical protein Bpet4142 [Bordetella petrii DSM 12804]
    MMIDSTPQYVDARELKAWIHDEAELALLDVREHGQFGENHLFFAVPLPYSELELHIARLVPRKGTRTVIYGDARTAGAVL
    AAAQALERLGYSQVHVLRGGIEAWREAGYASFAGVNLPSKTFGEIAEHIYHTPSVSAAQLHDMLNDPDRNVIVLDGRPVA
    EYRKMNIPGAICCPNGELALRIGELAPDPDTKVVIN
    CAGRTRSIIGAQTLINLGIPNEVYALENGTQGWYLADLPLEHQS
    SRVYPERIPAQSLSSLRQRSRQLQEKFGVTVVDAGQVRAWLEDDACNVFLCDVRTEEEHRQGGVPGRAQHTPGGQLIQAT
    DQYIGVRKARVVLCDTDGIRAPVVASWLKQLGWNVSLLQEPQQLDGVPAVPAAAPALSHTQDIPAAQLAAFVAGNPGVAI
    LDARPSMQFRKASLQAATWTIRPIIMQQLEGHANGPVLLLGDNRAKLAWLASDLERAGRADIHLCVVDDAGLRASGLPMS
    ARPELPDEACIDYLFFVHDRHDGNKAAARKYLEWETNLVSQIDEQERKTFSVGG

    >gi|163858860|ref|YP_001633158.1| hypothetical protein Bpet4540 [Bordetella petrii DSM 12804]
    MSDVQEFIRDTVTQHPVVLFMKGTAQFPQCGFSGRAIQILKDCGVKKLVTVNVLEDDEVRQGIKEYSNWPTIPQLYVSGE
    FIGGSDIMTEMNENGELKTLLETAGATTA

    >gi|163858870|ref|YP_001633168.1| arsenate reductase [Bordetella petrii DSM 12804]
    MSNITIYHNPACGTSRNTLALIRNSGEDPTVIEYLKTPPTRATLVKLLADAGLSVRDVLREKGTPYAELGLGDPKWTDEQ
    LLDFIEQHPILMNRPIVVTPMGTRLCRPSEIVLDILPQPQRGAFTKEDGEPVIDAEGRRV

    >gi|163858890|ref|YP_001633188.1| putative heavy-metal transporting P-type ATPase [Bordetella petrii DSM 12804]
    MARKSLPKQDLADHKHGPATHAFQHSHHRDEKDAKAPSTRHACEGHDHHHGSSHGRTTDAGVSRAGSSSAEYTCPMHPQI
    RQIGPGS
    CPICGMALEPVTVSLDGEQESSELRDFSRRFWIGLVLTLPVVVLEMGGHLFDIHRLVSPQLSNWLQFVLATPV
    VWWAGWPFFVRAWKSLVFRSLNMFTLIALGTGVAWIYSVVATVAPQWFPENFRTQGAVAVYFEAAAVITVLVLLGQLLEL
    RARERTSGAIKALLNLAPKTAVRVREDDSDETVALESIQVGERLRVRPGEKVPVDGEVLEGRCTVDESMITGEPIPVTKA
    PGSSVTAGTLNQTGSFVMRAERVGADTLLAQIVQMVAAAQRSRAPIQRLADQVAGWFVPAVIVASVVAFAAWLYWGPAPA
    FTYALIAMVSVLIIACPCALGLATPMSIMVGVGRAAQHGVLIRDAEVLEQMQKVDLVIVDKTGTLTEGKPKVTSIQPAAA
    VDRAVLLQMLASVERASEHPLATAIVDAAQEAKLALLPVENFDSPVGKGVIGTVDKKHIVCGSAKFLAEHGIVISAEDSG
    DSLRAKGATVIYVGIDSHYAGFVSITDPIKESTPQAIDALHRSGVRVVMLTGDSKATARAVAEQLGIDEAIGEVLPEDKS
    AAVKRFQAEGRIVAMAGDGVNDAPALAAANVGIAMGTGTDVAMESAGVTLLKGDLMGIVRARRASQATMRNIKENLFFAF
    IYNAAGIPVAAGVLYPIFGVLLSPVIAAAAMALSSVSVIGNALRLRVAKIDE

    >gi|163858899|ref|YP_001633197.1| putative Thiol:disulfide interchange protein [Bordetella petrii DSM 12804]
    MSAPLLVQTLLAIGAGLLLNLTPCVLPAVPLKVRAVLREAGERQAMRVTSAALFAAGSVAFFGSLGLATSLLQWRWGVLF
    QSRPLLIAMSALLTALAILSFFGRSLPLPNALVTLRGRRLLEPFVSGLVSALLSTPCTGPLLGGVLVFALAQPLANILVI
    FVAIGLGLAAPYVVLILRPSLLKRMPRAGAWTAVVQQSFGWLLLAAALFYAQSVLPAAWGTPIWIALLIAILGWAAVTFQ
    RATERSARTAAISVGVIAVVLGYFGSGLGQSSETAIAWQRLRATDVEALPTLGRPVLMEFTAQW
    CINCKVLEKTVYADRD
    VVAALKHTGTVPLQVDLTRPAPILEHLLASHGGVGLPFAVVLDDKGREVQALSGLFTSTSLVQALNKTLTQENGS

    >gi|163858962|ref|YP_001633260.1| hypothetical protein Bpet4642 [Bordetella petrii DSM 12804]
    MTRTTTLTPEQVPAESSATLNAFTKSLGFTPNMMAAFAQSPIAFNAWSALLGALSKALDVKTRDSIGLAVSEVNGCDYCL
    TVHSFTAEHMARMPADDILLARKGHANDPKRDAAIQFARKVIETRGKVSDADLQAVRDAGYTDANVMEIVALVAMYSLTN
    FFNNVFDPEKDFPAVAPAGSI

    >gi|163858969|ref|YP_001633267.1| putative methylated-DNA--protein-cysteine methyltransferase [Bordetella petrii DSM 12804]
    MTYAYKTIASPVGQLKLVASTSGLAAILWENDKPERVRLGPMREDVQHPVLLEAEQQLGEYFAGKRSGFDLPLDFNGTEF
    QKQVWAALLTIPYGQTRSYRDIAMQIGRDKAVRAVGAANGRNPISIVAP
    CHRVVGASGDLTGFAGGLRAKALLLALESGQ
    GRLAA

    >gi|163859012|ref|YP_001633310.1| adenylyltransferase [Bordetella petrii DSM 12804]
    MNDQQLLRYARHILLDELGIEGQEKFLAGKVLIVGAGGLGSPAALYLATAGVGDITLADDDIVELSNLQRQILHVDASVG
    RPKAESGRDTLAAYNPETRVTPRVERLDGQRLDDAVAAADLVLDCTDNFATRHAINRACVRHRKPLVSGAAIRFDGQVSV
    YDLRRDDAPCYHCLFPEADEVEEAN
    CATMGVFAPLVGIIGAMQAAEALKLLAGIGESLSGRLLWLDVRTMQWRSVNVQRD
    PECAVCGPAHAH

    >gi|163859016|ref|YP_001633314.1| hypothetical protein Bpet4695 [Bordetella petrii DSM 12804]
    MDLLQFLVDKNNIFIVAVALVSGIMLAVPALRKGRSGSGISTAEAIQMINQRQAVWVDVRPAEQFRAGHIAQARNMPAAE
    VEQKAGSLPKNKPLVLV
    CETGRDAGRVASRLRSQGFADVSVMEGGMRAWSSANLPVTQKS

    >gi|163859017|ref|YP_001633315.1| glutaredoxin 3 [Bordetella petrii DSM 12804]
    MDKVVMYSKDYCPYCARAQALLKQRGVTDLEIIRIDQDPAQRDIMIERTGRRTVPQIFIGERHIGGCDDLMALDRAGGLA
    PLLNG

    >gi|163859241|ref|YP_001633539.1| hypothetical protein Bpet4920 [Bordetella petrii DSM 12804]
    MAKRRISVPAAWRGGFHKEKNPMHQFMVHARPAWRVWWLGCLALLAWAVLAWRPAAALTEADFLPPEQAFVFSAAMADPG
    TIELRYRIAPGYYMYRERFGLSISPLGAATLGTPVYPQGDVKYDPTFEKNMEVYHQQVSITVPVTGQQPFSLTVTSQGCA
    DAGLCYPPADHTVRLVPVAGGYAVDGASLASADAGSAAVAGSSATATGLGSLLAAGDLGLADAIGGLGWLKTAGVFWVLG
    LLLAFTPCVLPMIPILSSIVVGGTDGARPGRWRGLGLAAAYVLGMSVVYTALGVAAGLSGAGLAAWLQTPWVLAAFAVIL
    ALLALATFGAFDFQVPGSVQSWLSARSARIPGGRATGALAMGAVSALILGPCVAAPLAGALLYISQTGDVVLGGAALFAM
    AWGMGVPLLVVGASSGALLPKAGPWMDGVKRLFGMLLLATAWWMLVPVVPTWLQMAGWAFLAIVAAVMLRAFDALPAGAG
    APRMFAKGLGLLLALAGLVWLVGAASGGRDVLQPLSHLAQRGGGPAPLAAAGPVEFKRVRTSAELDALLAQSTRPVMLDF
    YADW
    CVSCREMERFTFSDPAVASRMSRMLLLQADVTANNADDRELLKRFRLFGPPGILFFAPGGAPIADARVIGFQDAPR
    FAAVLDRVLAR

    >gi|163859306|ref|YP_001633604.1| O6-methylguanine-DNA methyltransferase [Bordetella petrii DSM 12804]
    MSFAPAMNASIPTDDYTTDDDRWRAVCTRDASADGQFVYAVRTTGVYCRPSSSSRLPRRENVQFFDTPQAAEAAGYRPSR
    RAAGDRSAVAARRAALVEQACRLIESADTPPSLDFLAAQAGVSAFYFHRLFKAETGLTPKAYADAHRARRLRRELGESAT
    VTQAIYEAGFNSNSRFYEASDSLLGMRPRDYKAGGFNADIRFAVGQCALGAILVACSQRGICAISLGDDPEALVRELQDR
    FPNARLHGADSAFEQLVAQVVGFVEAPAVGLNLPLDVRGTAFQQRVWQALRDIPAGATASYAEIADRIGAPKAVRAVAQA
    CGANQLAVAIP
    CHRVVRRDGDISGYRWGVERKRELLRREAGAAEAA

    >gi|163858909|ref|YP_001633207.1| putative secreted protein [Bordetella petrii DSM 12804]
    MTLLESEGGYLSRRAMLAAVALIPVASLAKTAVTVDVWKTSTCGCCKDWVKYLQDNGFQVSVRDVTDTSVARRQNRIPDD
    YGSCHSARVEGYALEGHVPAREIRRLLRERPAAVGLAVPSMPLGSPGMDGPAYGGKRFAYDVFLIGNAGEASVYQQYR

    >gi|163858582|ref|YP_001632880.1| putative secreted protein [Bordetella petrii DSM 12804]
    MPVQALRHRRSRKRWPWFLAAGLIALLLIWLVSRAPSEPASLAPAPVSTAQVAGPPWQMGNAQGRFTLTLYADLECPFCR
    EYFPQLKRWVGANADVALQWQHQPLAAHEPAASAEARLAECAAESGGHVAFWQAIEWVYAHTRSDGLGLPEGLRYPGLNP
    AVEQCLASERPETLIRAQAEEATKGGVTATPSLRLHDRQTSQAILLQGPIEGDALLSAMDMLAAEDSVVSPTTEMPADVV
    GDMPR