Acidobacterium capsulatum ATCC 51196 uid59127

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|225871897|ref|YP_002753351.1| OsmC-like protein [Acidobacterium capsulatum ATCC 51196]
    MVHIDVKYEGNLHCEAVHGPSGTALTTDAPKDNHGRGESFSPTDLVATALGSCMLTVMGIAARTLGVDLSGATASVEKEM
    ASSGVRRIAKLIVKIHVPGDVSAENREKLERAAHT
    CPVHQSLHPEVEKPVEFVWG

    >gi|225871900|ref|YP_002753354.1| antioxidant, AhpC/TSA family [Acidobacterium capsulatum ATCC 51196]
    MKKNLIFGVALVAALCSTAFAAALKPGDRAPLFSAPASLAGKEFHFSLKAALAKGPVVVYFYPSAYTGGCDLEAHTFAQE
    KDKFTAAGATIIGVSEDSIARLKQFSADPKFCAGRFPVASNPSGSIGAMYGVEAAGAVAGAKDVRGVEIDHGFFARTTFV
    IDPKGKIVSEFSSEADHLSPPEHVAKALAVVKKLDHK

    >gi|225871920|ref|YP_002753374.1| thioredoxin [Acidobacterium capsulatum ATCC 51196]
    MAGAGVIEVNDATFEQEVLQSEQPVLVDFWAGWCGPCKALAPTVDEVAAQYAGKLKVAKMDVDRNASTPMRYGIRGIPAL
    LIFKGGKVADQIVGYVPKDVIDRSLTKVLA

    >gi|225871957|ref|YP_002753411.1| hypothetical protein ACP_0267 [Acidobacterium capsulatum ATCC 51196]
    MTDTLNALAHSSSAYLRSAMHQPVRWHSWGDDAFALAAQEDKPVLLDIGAVWCHWCHVMDRESYENPAIAAVINEHFIAI
    KVDRDERPDVDSRYQAAVQAMAGQGGWPLTAILTPEGKPFFGGTYFPPEDRYGRPGFERVLRSLADVWQNRRGEALETAN
    SVLGAIEHGESFAGRSGTLSISIVEKLVSSAVQQFDARYGGFGSQPKFPHPSAMDMLIDTASRTGNERVREAATVTLRKM
    AAGGVYDQLAGGFHRYSVDEQWIVPHFEKMLYDNAGLLSNYVHAFQSFVEPEFAAVAVDIIRWMDECLSDRERGGFYASQ
    DADINLDDDGDYFTWTLAEARAVLSNEELAVAASYFDIGEMGDMHHNPQKNVLHSKRTLAEVAAALSLSAEEAQKKLDSA
    KSKLLAARRERPTPFIDTTIYTSWNALAISAYLQAARVLDLPHARTFALLTLDRILREAWSETSGLSHVVAYADGKSPAA
    WVAGVLDDYAFLTDACLEAWESTGDRKYYDAAAQIADAMIARFYDQTSGAFFDTEIQGSKLGALAARRKPLQDTPTPAGN
    PAAASALLRLASLSGEKRHAELAEDTLEAFAGVVEHFGLYAGTYGLALLRFLLPPAQIIVAGDGPRARELAAMAVARYAV
    NKSVVQFDAAQLAVENLPPALAETLPHLSGFTEPVALVCQGMSCQPPITEPQALLEALHSAV

    >gi|225872116|ref|YP_002753571.1| alkylhydroperoxidase AhpD domain protein [Acidobacterium capsulatum ATCC 51196]
    MTSEFATNSPQQETQQQHRAVPSSSNLPLVEEDSASEEVRALFGKYRETFGRNDLPGIVLCFATHAPMLRGMLEIAEGLL
    FVDTHLTRRQKEMIATFVSVQNACPY
    CADSHSYLFRAEGGSTELLCALRKAETDSPQFTPAEQELLRLCSRVNGDSHSVR
    PADMERARKAGWNEAQIAEAVHITALFAAFNRIANAFGLSSPYPNGLEGQP

    >gi|225872120|ref|YP_002753575.1| peroxidase family protein [Acidobacterium capsulatum ATCC 51196]
    MPHIALPEGLPGISAGFAFRPETAKPMRELAHLLLHEPNSLTPGERELIATYVSTRNDCYFCQTSHGAAAACHLGGNEIV
    EQVKTDPQSAPVTPKLKALLAIAGKVQQGGKQVTAGDIAAARAEGATDMEIHDTVLIAAAFCMYNRYVDGLGTWQPREES
    MYMGMGRQLAEHGYLKSSR

    >gi|225872121|ref|YP_002753576.1| peroxidase family protein [Acidobacterium capsulatum ATCC 51196]
    MPHIALPEGLPGIRGALAFRPATAKPLNELAEVLLFGPNSLAPGERELIATYVSHLNDCHFCQSIHGAVAAAHLDGDEDL
    VKRVKADFQHAAISQKLKALLLIASKVQRGGKHVTRADVEHARTLGATDTEIHDTVLIAAAFCMYNRYVDGLGTTQPLDE
    AMYRERGKMVAQKGYVEGSKDYLPAEAAAH

    >gi|225872163|ref|YP_002753618.1| hypothetical protein ACP_0484 [Acidobacterium capsulatum ATCC 51196]
    MRSSMSRLWLAAAAIVCLLSVMSQTARAQAIPGSARLQPAALAAMIHSAHPPMVLQVGSHTLFEEAHIPAAIYAGPASTP
    EGLQLLRQTVATLDKSTPIIIYCGCCPWTH
    CPNIRPAFQELHHLGFTHVKALYLAHNFGADWVQAGYPVTHGDTK

    >gi|225872164|ref|YP_002753619.1| putative thiol-disulfide interchange protein [Acidobacterium capsulatum ATCC 51196]
    MKTLTLLAALLLLPLAPNAAQAQQPAHSLNGHPAPRFQLKGLNGQPVSLAAYKGKVVLLNFWASWCAPCQAEMPTFEQWQ
    RSYGPAKFQVIGVSMDDGAAQAAAAVKKLHVTYPVAVGNAHLGNLYGGIDGLPVTFLIDRQGRIRAEYAGGNDQKAIHAE
    IDHLLAR

    >gi|225872274|ref|YP_002753729.1| ThiF family/MoeZ/MoeB domain protein [Acidobacterium capsulatum ATCC 51196]
    MPTSPSTAAERYSRQVLFAGIGPHGQQRIGESHVALVGVGATGAAAASLLARAGVGRLTLIDRDFVEESNLQRQVLFDEA
    DAREALPKAEAARRKIALFNSQIQVQSHVADLAPGNIHALLGDAQLVLDATDNFETRYLLNDYAIEQHKPWIYAAAVGAY
    AVTMNILPGQTACLACIFPEAPGGTVET
    CDTAGILNTAVNMAASIEVAEALKFLTGQPERMRRSLLSIDQWTNEWSEVKT
    ARPHPGCQVCGARDFRHLRGEGRPHITLCGRNSVQIHEHARPVDFAELAARLRPHGDVRSNSMLLRFQRGEHTLTVFQDG
    RAIIQGTTDVGLARSLYARFIGS

    >gi|225872336|ref|YP_002753791.1| DSBA-like thioredoxin domain protein [Acidobacterium capsulatum ATCC 51196]
    MISRRTLHSLAMPAILMAGALTLTISAQAQASMPAAPSASTPSAPTPATEAQLPPVNPKNFTAAQPTKAEVESFLKTSWG
    YDTNRSYEVYGILKTPAPGVSKVIIFVAEKGRPQVAGLTFFVTPDGHYLIANDSIIPFGPHPFAAARATLQQDATGAWQG
    SASKQHELVEFADFQ
    CPHCKAAQPTAKKLVADFPNARYVYQPFPLVNVHPEAFKAADYGNCVTRIGGNTAFFKFADSVFA
    NQNDLVNDGGTKTLDAAVTAAGLDPAKVAACAASPAGKAAVQADLKLANELNVNETPTLFVDGRPVPMTELPYPELKKII
    EYQFNLDSNTTSAK

    >gi|225872342|ref|YP_002753797.1| rhodanese domain protein [Acidobacterium capsulatum ATCC 51196]
    MLPYEITATEAAQLLEQAQQSEKPQFILLDVRERAEIQTARVPGALWIPMGEIPSRVQELDPDTHIATMCHAGVRSMNVA
    VWLRDQGFEKVQSVRGGIDAWSQTVDPNVPRY

    >gi|225872556|ref|YP_002754011.1| putative thioredoxin family protein [Acidobacterium capsulatum ATCC 51196]
    MRFRFFQALPALLVLPLVLVCVLAGGCNDNTHPGAIGHPAPNFTIHNGAETVSLKQYRGHVVVLNFWASWCPPCLEEFPS
    LIKLQQEMPDIRVVAVSFDTDKQAYDQYLLQNRIGGITTAIDPTQKTNRKFGTTRPPETYIINRKGVIVRKFIGPQDWTS
    PEIVNYLKAL

    >gi|225872627|ref|YP_002754084.1| thioredoxin, DsbD family [Acidobacterium capsulatum ATCC 51196]
    MPNFPAWPGRASRFVWQAMLCLMLLCTLAACTPARAQDSLSAQHLRLTLLMPPAQLYPGQTFTAGLDFQMDPGWHIYWIN
    AGDSGEPPNVKWMLPKGVTAGELQYPPPQRLPLGPLMDFGYENEVVLPVTMHVAPGFHPGSTHAEILADVSWLVCQNVCL
    PGQGTLKITRETLPRAPAIPTVNIQAQQKIASFEAKMPQPLPRGDMARFQTTAKGFRLAVLLGHKEAKAEFFPLDFTVIA
    NAAPQPVEPLQKGVALSLTKDDSMQQAPKRLHGVLEVGSGQAYLISALPGSLPASAMEQGSSVMPMLRAVLLALVGGMLL
    NLMPCVFPVLFIKGLALVQSSQHERKKMRAHGWVYTLGILVSFWAVVAVLLILRAAGQQLGWGFQFQSPLFLALMAMLLF
    FMGLSLAGQFEIGLTLTSAGGSLAQKQGYAGSFFTGVLAMVVATPCTAPFMGPAIGYALAHSAMTSFAVFTGVGLGLALP
    YLLLAYNPGWTRLLPKPGAWMEILKQAVSIPIFGTVIWMVWLYTESAGSYALMALLSAFLLLAIAGWTLGRWPAKRVATL
    VALLIIAAAIALPWYVGRVLGDSTQQTKTAASRAGAQTEWQPYSPALLQQYLSEGKPVFVDFTADW
    CLSCQVNQRVVLDR
    DDVQKALKSSGVELLKADWTHHDKNISEALQQLGRSGIPTYALYSGQAGAPPQLLPEVLTPGIVFNALNSLPHTATVGSA
    GSASASSATTAK

    >gi|225872703|ref|YP_002754160.1| putative glutaredoxin family protein [Acidobacterium capsulatum ATCC 51196]
    MKLVLYSASWCRDCREAKRFLEQHRIPFTEIDIEEAPGAAEEVLRHVGKRAIPQFVIDGEWVQPYRPGRGFLYEEMSLRL
    GLVQEEA

    >gi|225872867|ref|YP_002754324.1| hypothetical protein ACP_1227 [Acidobacterium capsulatum ATCC 51196]
    MPNSKRKVEVFSAGCDVCDETIALVQKLTCVSCDVVVYDIHKPEAAAKAAHYGVHAVVVNGNLAECCAGT

    >gi|225872869|ref|YP_002754326.1| pyridine nucleotide-disulphide oxidoreductase [Acidobacterium capsulatum ATCC 51196]
    MNKQFDLIAIGTGSAASSVASRCRAADWQVAVIDSRPFGGTCALRGCDPKKVLVGAAELIDWGRRMQGKGIQAGELKINW
    RELMHFKRTFTEPVPKHREEGFRKAGIEAFHGRARFTGPTSIQVGEDTLEARHIVIAAGQKPADLKIPGSEHLIDSEHFL
    ELDSLPSRILFIGGGYIAFEFAHVALRAGAQVTIVHRDSRPLRQFDSSMVELLVQHTRASGADIQLETEAVAVEKQSGGL
    AVRVSTSGQMRTLYADMVVHAAGREPEIDDMNLDAGDVAWDRHGVKVNEYLQSVSNPAVYAAGDAAASGGPPLTPVASYD
    GVLVATNLLKGNHAKPDYNGIPSAVFTIPPLASVGLTESAAREKGLKFTVKTESTGSWYSSRRVGESSSGYKTLVEERTD
    RILGAHLFGGAAAEVINVFALAIRSGIPARDLKHMIFSYPTHGSDVSYML

    >gi|225872870|ref|YP_002754327.1| mercuric transport protein periplasmic component [Acidobacterium capsulatum ATCC 51196]
    MKNLSRLFVVALLAAPISAFAATRTVTLNVPGMTCPVCPITVRKALRDVPGVEKVDVRYAKKEAIVTYDNARTDVAALTK
    ATADAGYPSKPEGRSK

    >gi|225872918|ref|YP_002754375.1| antioxidant, AhpC/TSA family [Acidobacterium capsulatum ATCC 51196]
    MSYMQEAEAFKAKAQERLGDQFKILTDDMSRVRSSGVLDQARKVNDGAPDFSLPDAYGHEVSLTTLLKAGPVVMSFYRGE
    W
    CPFCNLELRSLQQALPQIKKLGAGLIAVSPEKPDGGLLVTEKNHLTFPVLSDFRNEVARQFGIVFRVGDEVQNLSRTVF
    QNDLALRNGEDSYELPVPATFIIDRSGIIRFAHVEVDYMTGRVEPESVVSALEAIVRSEVR

    >gi|225873113|ref|YP_002754572.1| pyridine nucleotide-disulfide oxidoreductase family [Acidobacterium capsulatum ATCC 51196]
    MESSRSYSTDVLVIGAGPTGLACAIDAQQAGYRVMVVDKGCLCNSLFHYPSHMTFFTTSELLEIGNIPFPSPHAKPNRNE
    ALEYYRKVAMHYRLDVRQYQTVLSVDGEDGDFRILTSDRYGRERTYTARKLILSTGYYDLPNNLNVPGEELPKVMHYYTD
    PHPYYDQDVLVIGGKNSAAIAALELWRHGARVTLVHRGPEMHRHVKYWIKPDIENRIKNGEVQGLFSTRVVEIGLDTVTL
    ETPDGLKIVPNDFVFAMTGYKPDFRFLESLGVRIEGPDRMPVFDPESLESNVAGIYLAGVIVAGARTNEIFIENGRFHGR
    QIASDLAIKLGAQPQSVAEVRPGR

    >gi|225873296|ref|YP_002754755.1| thiol-disulfide oxidoreductase [Acidobacterium capsulatum ATCC 51196]
    MLLMMVTGLGLMIWAGVENYSARQQDDVKVQSLEAELHQIETQADSAHVGTDATQAPDTPLLGEQAPDFTLTSLDGKKIS
    LKSYRGKAVIVDFWATW
    CGPCRVEIPWFEDFRQQYGPQGLAVLGVSTDQLDDSDTAKAHQVVTDFAKQIHMNYPVLMATD
    SVEQQYGGISALPTTFFINRSGQVVASTIGLAPHSVIEADIKKALGTGGNA

    >gi|225873421|ref|YP_002754880.1| methionine-R-sulfoxide reductase [Acidobacterium capsulatum ATCC 51196]
    MDKIQKSDAEWREELTPEQYYILRQKGTEPAFTGALYRNHDSGAYHCAACGALLFKSDTKFESGSGWPSFWNPAENAAVE
    AHEDNSHGMRRIEVTCARCGGHLGHVFPDGPRPTGLRY
    CINSASLRFEKEK

    >gi|225873451|ref|YP_002754910.1| organic hydroperoxide resistance protein [Acidobacterium capsulatum ATCC 51196]
    MKVLYTSDVTATGARHGHVRSSDGLLDAPLALPKEMGGNGGATNPEQLFAAGYAACFGGAVEYLAAQQKLRTGEVTVRAQ
    VGIGPYDEGQGEGFTLCVALDITLPELTQAEAEALVAHAHRT
    CPYSNATRGNIDVTLTAHGGKA

    >gi|225873453|ref|YP_002754912.1| 4-carboxymuconolactone decarboxylase domain protein [Acidobacterium capsulatum ATCC 51196]
    MEQRIDYAKAFPEGYQAMIHLEGAVRRSGLEPALLELVKIRASQLNGCAFCIDMHTKDARHKGETEQRIYALSAWRETAF
    FTGRECAALAWTEAITNIQQGHASDAVYAEVREHFSEAETVKLTWAIGAINVWNRVAVAMRPAVGGYEPQG

    >gi|225873454|ref|YP_002754913.1| oxidoreductase, FAD-dependent [Acidobacterium capsulatum ATCC 51196]
    MTASVSSYDVLVIGAGAAGLMCAIEAGKRGRRVAVLDHAERAGKKILISGGGRCNFTNLHCRAENFLSENPHFAKSALAR
    YTPRDFLSLVEKHGIAYHEKKLGQLFCDHSAQQIVDLLLHECAEANVTLHLRTQVNQVRHSGGFELDTITPQGPVTFHAP
    ALVIATGGLSIPRMGATGFGYDVARQFGLRVIEPRPALVPLVLGEAGQRDWCQLSGLSAEVIASTSTPGAQRARFQEKML
    LTHRGLSGPAVLQISSYWRPGASLTLDLAPRANITAPLLAQPQRDISKARAALREHLPQRLADRLITLAPPSSFSNRALE
    AWEEHLHHYRFTPTGTEGYEKAEVTAGGVDTAELSAKTMESRIPGLYFIGEVVDVTGHLGGFNFQWAWASGAAAGRAV

    >gi|225873490|ref|YP_002754949.1| thioredoxin family homolog [Acidobacterium capsulatum ATCC 51196]
    MLAAMMGGLMASLALTPTAGAQMSGLYSAEVHKVIYPAPSAAPAEIEHALMVARREHKRVILDFGGNWCPDCKVLDYYFH
    QAPNATLLARNFVLVDVNIGRFDKNVNLAKKYGVPLHKGVPALAVLNAHGRVIYSQKNGEFENMRHMSPESVTAFLTAWK
    PAR

    >gi|225873549|ref|YP_002755008.1| metallo-beta-lactamase family protein [Acidobacterium capsulatum ATCC 51196]
    MTIQQFLTPGLAQYAYLIASEGQAVVIDPMRGDPRPAAYAAAHALRITHVLETHIHADFASGAPVLAQTTGAELALSAYD
    EGELYQYAMPHLRLSDGERIAVGRLTLEALHTPGHTPEHLSFALYDSDRNNSAPVALFSGDFIFPGSLGRPDLLGEDAKV
    GLAHALHRSLHHRIAHLPGTVRLYPGHGAGSLCGAGIGEQAESTLGQERLTNPLCQLAEDDFVREILAGVPPMPAYYPRM
    KQLNATGAAAWETLPTPAALSPAEVHALDSTQSILLDLRTPEAFAAGHIPGAIHIGAGASLPLWAGWLLDPARPITLISE
    TGDDPESRLALARVGLDRVTGFLAGGMSAWRAAALPERILPRLSPSEVEERATHALLLDVRNPGEWQLGHIPGARHLMLG
    DLPAQLATLSPHQPIIAI
    CQGGYRASAAASLLARAGFRDVATLAGGMTAWNQHTLALQSR

    >gi|225873724|ref|YP_002755183.1| putative lipoprotein [Acidobacterium capsulatum ATCC 51196]
    MSRIRMILACCALALVTAGCRAQAPAQKPVSVLHQRIETAIRNELNVPPEYDITISPQSPSKMAGFNAITVTFSLPGHPD
    HTQQLRYLVSTDGDTLARLSKFDISQDPDFVLPIQGRPVRGNPKAKVTIVNFDDLE
    CPFCARMHSELFPDIYDHYKGLIK
    VIYVDFPLTELHPWAMHAAVDANCLADESRTAYWNFVDYVHTHGEDISGPDHDTAKSFSRLDKIAEGEGQRDHLDTAKLN
    ACVAKQDESVVKKEMAAGDKLGISATPTFFVNGVRWSGVLDPAELKMMIDRALRQQGITPPPDADAPAPATTAAAAH

    >gi|225873739|ref|YP_002755198.1| putative thioredoxin family protein [Acidobacterium capsulatum ATCC 51196]
    MCLCGASTAWAKPVPNLKFKDMAGHTVRLDSLRGHPAVVNFWATWCGPCKEELPRLSALQAAYAGRGVKFVAVSVDEPKD
    FAKIKPYFERHQIALPVWTGADLGTLGRLGFGNVVPATLVLDGQGNVVGRIEGEARDADVRGYLDWLLDGRQGKAPPKRL
    RRY

    >gi|225873873|ref|YP_002755332.1| putative peroxiredoxin bcp [Acidobacterium capsulatum ATCC 51196]
    MELHEKVANFTLQNEEGETVNLTDYAGTPVILFFYPRADTPGCTIEACGFRDHFKKLQKEGVVVLGISRDTPKAQKKFKE
    KYDLPYTLLADVDETVCNQFGVLKDKNMYGKKVKGIERTTFVIGADQTLVKIFPKVKPEGHAEEVLAALKEMKK

    >gi|225873962|ref|YP_002755421.1| soluble pyridine nucleotide transhydrogenase [Acidobacterium capsulatum ATCC 51196]
    MAKYDLLVIGSGPSGQRAAVSAVKKGKRVALVEMRSVVGGVCINTGTIPSKTMREAVLHLSGYSYRSIYGMNYRVKEKIT
    MSDLAFRVQHVIKTEIDVTEAQLSRNMVDVIHGVASFESPNQVRVDGPRGATTYEADNIVIAVGTKPASTPKVPINGKTI
    VNSDQVLELSDLPRTMIVVGGGVIGVEYTCMFATLGVRVTLVEKRPRLLEFADQEIVEALSYHLRDSRVTMRLNEEVESV
    EELPDGTVVANLESKKRISGDALLYSVGRQGNVDELNLAAAGIEADKRGRIPVDKDFRTKVPHIYAVGDVIGFPSLASVS
    MEQGRIAVERAYGNELMQSNPSFYPYGIYTIPEISFIGKTEEQLTEEDVPYEVGVAYYREIARGQIRGDTTGRLKIIFHR
    ENREILGVHIIGEGASELVHIGQAVMALGGKVDYFIDTVFNYPTLAECYKAAAFNGINRLARFES

    >gi|225874003|ref|YP_002755462.1| methionine-S-sulfoxide reductase [Acidobacterium capsulatum ATCC 51196]
    MAKATFGAGCFWGVEASFRQLHGVQDVAAGYEGGKLDNPTYRDVCTDLTGHAEVVEIDFNPDEIRFEQLLEAFFGLHDPT
    QLNRQGPDWGTQYRSVIFYHSPEQQTVAQAFIDRLTAEKRFPRPIVTQVVPAATFWRAEEYHQRYLEKRGLATCHI

    >gi|225874037|ref|YP_002755496.1| ADA regulatory protein [Acidobacterium capsulatum ATCC 51196]
    MPAATVSISTTQPDATEAWAEAWAAVERRDKRARGFVYAVTTTGVFCRSGCPSRRPARDNVRFFADAAAARAAGFRPCLR
    CRPEEAPGEAVRARRMADFLDAHRDRPVTLAELGRLTGRSPFTAQKIFRRVLGLTPAEYQRQARARALREELSRGDSVTD
    AVYAAGFGASSRVYASAGDVLGMRPGQFRRGGEGVVIRYWTAPTLLGEMLVARTERGICAVALGAEREGLKRELRERLEA
    AELREDPSLAGEIEALAQACRESPAALLDLPLDLRATAFQMRVWEALRRIPAGETRSYREMAAVLGNPKAVRAVARACAS
    NPAALLVP
    CHRVVGSDGQLTGYRWGVERKRKILDLEAKQRRG

    >gi|225874087|ref|YP_002755546.1| putative organic hydroperoxide resistance protein [Acidobacterium capsulatum ATCC 51196]
    MERTASAVWHGSLKEGKGAITTQSGVLGDTQYSFSTRFEHGTGTNPEELIAAAHAGCFTMALSAQLGNANLTPESLETTA
    AVKFEKTEQGFTITAIRLTTRAKVPGANQAAFETAAQNAKNG
    CPISRLFQGNTEITLDAKLV

    >gi|225874115|ref|YP_002755574.1| iron-sulfur cluster assembly accessory protein [Acidobacterium capsulatum ATCC 51196]
    MATSQTSGSAAGASAPAAKGIEVTPKAIARIRVAMQQEGISPEQGGLRLGVQGGGCSGLSYSVRFDTQPRERDRIYTYDD
    VRIFVDPKSFLYLSGMILDYEETLMRRGFNFINPNSKKSCGCGSSFSA

    >gi|225874125|ref|YP_002755584.1| antioxidant, AhpC/TSA family [Acidobacterium capsulatum ATCC 51196]
    MGLRINDIAPDFTAETTQGTIHFHEWIGDNWAILFSHPKDFTPVCTTELGAVAALESQFAARGAKVIGLSVDPVDSHSNW
    EKDIEEVGGHKVNYPIIGDPELKIAKLYDMLAADAGESCEGRTPTLNAPVRTVFVIGPDKKIKLTLSYPMTTGRNFDEII
    RVLDSIQLTAKHPVATPANWKQGDDIIIGGAVSNEEAATKFPGFKTVKPYLRTAAQPK

    >gi|225874202|ref|YP_002755661.1| antioxidant, AhpC/TSA family [Acidobacterium capsulatum ATCC 51196]
    MSRFWIIVLVAVVVTLGGLALRSFAAKVPGMPRVGQMAPGFTLPNQEGQPVSLDSQRGKWVVLYFYPKDMTPGCSIEAHN
    FQRDIEKYHAANALILGVSLDTVKSHKKFCTKDGLGFTLLSDHQAQVSKDYGVLGNYMGFKIDHRVTFLINPEGRVVKVW
    PKVSPSGHSEEVLAELAAQQKA

    >gi|225874262|ref|YP_002755721.1| thioredoxin-disulfide reductase [Acidobacterium capsulatum ATCC 51196]
    MTEAIFDTVILGSGCAGLTAAIYTARANLNPLVLEGHEPGGQLSITTLVENFPGWPEGIQGPELIDNMRKQASRFGAQFR
    LGHLVKADLSKRPFVLDLGREVIHARTLIIASGASARWLGLPSEQALIGHGVSS
    CATCDGFFFSGKEIAVVGGGDSAMEE
    ALFLTRFATKVTLLHRRDHFRASRIMLERAMAHPKIEFRTNVSVEEVLGVEEKDVRGVRLRDTVTGEESELAISGLFLGI
    GHEPNAGMFAGQIDLDDDGYIRTHDQVHTRVPGVYACGDVQDRRYRQAITAAGSGCMAALEVEKFLEEHGR

    >gi|225874287|ref|YP_002755746.1| pyridine nucleotide-disulphide oxidoreductase [Acidobacterium capsulatum ATCC 51196]
    MRESFDAIVVGAGQAGPSLARRLAKAGRKVAVVERHLFGGTCVNTGCTPTKAMVASARAAHMARRGEDFGFSAGPVAVDW
    GAVKRRKNQIVEKSRTGVEKGLRETENCTVFTGTASFESSSCMRVGDHRLEASQIFLNVGARPFIPDLPGVDKVPFLTSS
    SILDLDELPEHLVVVGGGYVGLEFAQMFRRFGSQVTVVDRGGRLAPHEDEEASKVIDEIFRAEGIASRTSAECIHLEVDG
    KQVAVGLTCGEGEPRIVGSHILLAVGRIPNTDDLNLQAAGVVTDEHGYIQVDDQLRTNVPGIFALGDCNGKGAFTHTSYN
    DFEIVAENLLDGASRRVSDRIPVHALYLDPPLAHVGMTETEARRRGEPILVGMRPMSHVSRAIEKSETFGFIKILVHAET
    RQIVGATLFGPGCDEAIHCILTAMYAHQPASLLTHSVHIHPTVAELIPTTLADLKPLGE

    >gi|225874414|ref|YP_002755873.1| dihydrolipoyl dehydrogenase [Acidobacterium capsulatum ATCC 51196]
    MAETIYDVAIIGGGPAGYTAAIRAGQLGLKAALIEKEAKLGGTCLHWGCIPTKSLLFNAEIYDYLKDAKEYGLEGLGEAK
    INWKTILDRKNQIIAKHAKGLDFLMRKNKVTVIPGYGKLTGAAKDGIHSVEVTGEGKGKAETVKAKNVIVATGSDAKLLP
    GLKTSDKILTNMEILTINGIPKSLVVIGAGAVGVEFGSIFRSFGSEITIVEYLPRLVPNEDEDVSKELARVFRKRGIESH
    VGAKVEKVEETKTGVKVTFTAADGKQVVKEADKVLVAVGRAPRTENIGLEKTKIKPERGFIKVNEFMQTEEPGVYAIGDI
    VAGLPQLAHVGAMAGVVVAAKIAGKYARPVKRERIPGCTYTEPQIGSVGLTEAQAKEKGLQIKVGKFPFSANSKASIVGQ
    HEGFIKVVADAKYGEILGVHIIGPQATELIAEAVTAIELEATVDDMMFTIHAHPTLAEAMLDGFGSVEGMAINM

    >gi|225874446|ref|YP_002755905.1| rhodanese/MoeB/ThiF domain protein [Acidobacterium capsulatum ATCC 51196]
    MATTTQTAAALPQLTNQDIARYSRHLILPEVGMEGQQKLKAAKVLCVGTGGLGSPLALYLAAAGIGTLGLVDFDVVDESN
    LQRQIIHSTKDVGRPKIESAAEKLLALNPALNLVKHETMLNSQNALEIIQQYDIVADGTDNFPTRYLVNDACVLTGKPNS
    YASIFRFEGQASVFATEEGPCYRCLYPEPPPPGLVPS
    CAEGGVLGILPGLLGVVQATEVIKLILGNGEPLIGRLLLVDAL
    NMKFRELKLRKNPNCPVCGENPTVTKLIDYQQFCGIVPEAPPAAVQNGVPQITVHDLKRKRDAGENFFLLDVREPHEFQI
    AHLNGHLIPVNDLPNRVNELEQARQAGQEIVVH
    CKSGGRSQRAAEFLKQQGFANVVNVAGGITAWATEIDPKVPKY

    >gi|225874591|ref|YP_002756050.1| hypothetical protein ACP_3041 [Acidobacterium capsulatum ATCC 51196]
    MAHLQDQLDLITENTRNLVQPERLAISDRAVEELFTTGIEQHILPVGAKAPEFELPDATGRTVRSQDLLALGPLVINFFR
    GRW
    CPYCVTELEAWRDLYPVVREQGGLVVAISPQTQRQSDFTAGHHKLPFPLLTDFECQLASQFGLMYSVPDYQRNYYRS
    ILVNIPFVNGEESWRLPLPATYVVGQDGTVVFAEAYADFRVRPEPEEVLAPLLARQR

    >gi|225874593|ref|YP_002756052.1| alkylhydroperoxide reductase C [Acidobacterium capsulatum ATCC 51196]
    MLTVGEKFPSFSVTATVSTDKNKAFETITDESYAGKWKIYFFWPKDFTFVCPTEIAAFGKLNGEFQDRDAQVLGGSIDSE
    FVHLAWRNNHEDLKDLPFPMLADVKRDLCGQLGILDVNAGVAQRATFIVDPENIIRFVYVTDLSVGRNPQEVLRVLDALQ
    TDELCPCNWQKGEETLTV

    >gi|225874653|ref|YP_002756112.1| iron-sulfur cluster assembly accessory protein [Acidobacterium capsulatum ATCC 51196]
    MATATAAPETVKPATPLTLTDKAVEKVREIMATQDPLPSGLRIGVVGGGCSGFQYSMSFENQAGMMDKVLSFDNLKVYVD
    ATSMMYLSGCVVDYVETLEAAGFKFENPSVKSTCGCGSSFSV

    >gi|225874889|ref|YP_002756348.1| glutaredoxin family [Acidobacterium capsulatum ATCC 51196]
    MKKVTLYSQPGCPPCFAAKAFLQSRNVPFEYKDVQADPAALQELLALDSRSTPTLVVGEEVMIGFDPDRLTRMLEG

    >gi|225874965|ref|YP_002756424.1| hypothetical protein ACP_3429 [Acidobacterium capsulatum ATCC 51196]
    MPTRRFTRSLALVLALAASPLLLRAAQPSGGPAAATILHRAEAQARAQHKNILLEFGASWCINCKLYDRMLDDPTLSPIL
    HRYFVFTTMDTGEMPSDHHHADTPGGVAYETSIGGKGAGWPYLVVLNPAGKPIVNSFRPDPKSKDGKANIGYPALPVEID
    WFMTMLHRGAPAMSAADRAKVRTWLEAEAKTLTHS

    >gi|225874984|ref|YP_002756443.1| putative thioredoxin family protein [Acidobacterium capsulatum ATCC 51196]
    MATKRVSFLKSAIVAAACLVVLTPYGRAASDSFKPLTRVGEAMPSFTVKELSGSTFSMARERGKVVVVNFWATWCPPCRL
    EMPRLEREIWDKYQSNPGFAMVAIARQQTEATIAGFHKAHVEFTYPLAYDPARKVYAKFADAGIPRSYVVDKHGRIVFQS
    VGYQAGDIQKLNRAVEKALAAR

    >gi|225874989|ref|YP_002756448.1| DedA family protein [Acidobacterium capsulatum ATCC 51196]
    MPFALHFFLQHAYMILFLWVLVEQLGVPIPSTPILLAAGTLTATRQLALPAVIIVALAGSLISDSLWYWMGKRYGGLMVR
    LLCRLSFESTVCVRKTEEYFTRRGPASLLVSKFIPGLGTVAAPIAGQTGMSFRRFVFYDAGGILLWTLSVTLGGRFFGDI
    LKRHPNALSWTGHFALGLFLLLFAGFLAWRFFKQRMFLAEIRMARIFPDELKTRIEEGDDVIIVDLRHPLDLLPDPRTLP
    GALRLTPDKLMAQLEQIPRDREVILFCT
    CPSEATAAKTALQLRRAGIQRVRPLYGGFDEWKKRGYPLVEGNADLALEYAR
    G

    >gi|225874681|ref|YP_002756140.1| hypothetical protein ACP_3132 [Acidobacterium capsulatum ATCC 51196]
    MIASAEWKQGSLYAGNTESNHTIFFDTTAEHKAGPSPMEAVLAALCGCTSVDVAGILQKKREPIRGLTVSARAEQAEQPP
    RVFTHIHLTYRIEGDVTQKAAEDAVSLSKNKYCSVSKMLEQSVKIDYSIEIIRGGAETTA