Bordetella pertussis Tohama I uid57617

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|33591371|ref|NP_879015.1| thiol:disulfide interchange protein DsbA precursor [Bordetella pertussis Tohama I]
    MQSTTFTRLLAAAALGATTLFAPATQAQGAQQYVNINPPMPSDTPGKIEVLEFFAYTCPHCAAIEPMVEDWAKTAPQDVV
    LKQVPIAFNAGMKPLQQLYYTLQALERPDLHPKVFTAIHTERKRLFDKKAMGEWAASQGVDRAKFDSVFDSFSVQTQVQH
    ASQLAEAAHIDGTPAFAVGGRYMTSPVLAGNDYAGALKVVDQLIVQSRK

    >gi|33591510|ref|NP_879154.1| stringent starvation protein A [Bordetella pertussis Tohama I]
    MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMNPYGQVPILVERDLVLYESNIINEYIDERFPHPQLM
    PADPVMRARTRLFLYNFEKELFVHVCALEDRSAKPDDKKMVQARQSIRDRLAQLAPMLLKNKYMLGDEFSMLDVAVAPLL
    WRLDHYGIELPKNAAPLQKYAERIFSRPAYIEALTPSEKVMRR

    >gi|33591568|ref|NP_879212.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella pertussis Tohama I]
    MRGTRAPHTVKAPSNQERIMQFFQAQLESPLGALSLVTDDRQQVRALEFADSPQRLQRLLHLHYGTYTLREAPAPAAIVT
    ALAHYFSGQCDALDGIATATGGSALQQRVWQALRRIPAGEVTSYGALARQLGHDDRQAARAIGGANAANPIALIVP
    CHRV
    IGKDGALKGYAWGLERKRWLLAHENAAAGLLREAG

    >gi|33591613|ref|NP_879257.1| putative thioredoxin [Bordetella pertussis Tohama I]
    MKKIALVLIIAVAAGIGGWFMWRPAQTAPDVAFTTLEGQKITMQDLRGKVVLVKFWATSCVTCVKQMPDNIANYNQYHPQ
    GYETIAVAMNYDPPNYVLNFAQTRKLPFPVALDTSGELAQAFGNVRLTPTAFLIDKQGQIIKRYLGEYDKAEFQATVQKA
    LAG

    >gi|33591617|ref|NP_879261.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella pertussis Tohama I]
    MNPPSAQATDILYCDTDTPLGPMRLAARGQALCGAWFVDQRDCPAAAGWTLDAAHPALRQAAAELEQWFAGRRRAFEVAM
    QPEGTPFQRQVWQALLELPFGATISYGELARRVGRPKAARAVAGAVGRNPISILIP
    CHRIIGHDTSLTGFGGGLPRKQAL
    LAHEGHRYLSRAARARRVSTTQMELPLGAA

    >gi|33591740|ref|NP_879384.1| carboxymuconolactone decarboxylase [Bordetella pertussis Tohama I]
    MLDWNQYRSELMTRIGEIAKASPETVKGYQQLSAAGKQTNQLDAKTRELIALAVAVTTRCDGCIAVHAKAATDNGATKGE
    IAEALGVAVALNAGAALVYSARVMDAVDAAQ

    >gi|33591804|ref|NP_879448.1| glutaredoxin 3 [Bordetella pertussis Tohama I]
    MQKVVMYSKDYCPYCARAQALLKQRGVADLEIIRIDQDPSQRDIMIERTGRRTVPQIFIGETHVGGSDDLQALDRSGGLL
    PLLNGG

    >gi|33591805|ref|NP_879449.1| hypothetical protein BP0606 [Bordetella pertussis Tohama I]
    MDLLQFLIDKNNVFIVAVAVVSGIMLMLPALRKGRAGAAVGTSEAIQMVNQRQAVWVDVRPTEQFQAGHIAQARSLPAAD
    LEKKAGALPKNKPLIVV
    CEQGRDAARIAARLRSQGFAEVSVLEGGMRAWFAAGLPVTQKG

    >gi|33591809|ref|NP_879453.1| adenylyltransferase [Bordetella pertussis Tohama I]
    MNDQQLLRYARHILLDELGIEGQERFLAARVLIIGAGGLGCPAALYLATAGVGHITLVDDDVVELSNLQRQILHASDSVG
    RAKAESGRDMLARFNPETQVEARVERLGGAALDAAVAQADVVLDCSDNFATRHAINRACVRHRKPLVSGAAIRFDGQVSV
    YDLRDAQAPCYHCLFPEADDVEELN
    CATTGVFAPLVGIIGSGQAAEALKLLAGIGQSLAGRLLQLDVRSMQWHSVNVPRD
    PDCAVCGQGGQAAEHARGDAAHCA

    >gi|33591816|ref|NP_879460.1| dihydrolipoamide dehydrogenase [Bordetella pertussis Tohama I]
    MASTMETDLLVLGGGPGGYTAAFRAADLGLSVVLVEQRPTLGGVCLNVGCIPSKALLHCAKALDEARAMSELGIEFSEPR
    IRLDKLRAHKEALVAKLCGGLGGLARQRKVEVVTGTGRFDGPHSLAVSDGSRVAFKQAVIAVGSRPVRLPFLPDDPRIMD
    STGALELKEIPRRLLVIGGGVIGMELATVYAALGARVTVVELTDGLLPGCDRDLVKPLAQRVASRYEAVLLGTRVSAAQA
    RDDGIHVSFDGPQAPGPQVYDQVLVAAGRRPNGAAIDAERAGARVDEGGFIRVDAQQRTNVGHIYAIGDVVGEPMLAHKA
    AHEGKVAAETAAGMRVANDARVIPAVAYTDPEVAWVGLTETAAQRDGIAYEKAAFPWAASGRALSLGRGEGLTKILVDPA
    THALLGVGMVGPQAGDLIAEAALAIEMGAEPGDIALTIHPHPTLSETLAFAAEAYEGTLTELYLTRKKS

    >gi|33591873|ref|NP_879517.1| hypothetical protein BP0680 [Bordetella pertussis Tohama I]
    MSDVQEFIRETVTQHPVVLFMKGTTQFPQCGFSGRAIQILKGCGVKKLVTVNVLEDDEVRQAIKTFSNWPTIPQLYVGGE
    FIGGSDIMSEMNESGELKQLLDDSGATA

    >gi|33591986|ref|NP_879630.1| hypothetical protein BP0818 [Bordetella pertussis Tohama I]
    MTTMQQRYDAVKDAMAQIGRLAAQLDGEALREAIGPVLVALGERDELFPRDEFPIRAGKPGGLYQLWRGESGDLALYASA
    GKTGKKQPPHDHTTWAVIAGVYGEEHNVFFERTDDGSRAGFGTLRQIDALTVVQGNAARLSGEVFHTIEVVSEEDSLHLH
    LYGRALDTLSGRINFATEEGGAYTRFMAVPETYAPWIAPRDLYEMLTDGGELAILDVRENGVYTQGHLFHAASMPLSVFE
    LRVDDGLPSPHVRIVVIDDADGLAEQAVRLLHQRGYHNVAVLQGGQPGWNAAGLPVYTGVFVPSKAFGEVAEHVYGTPSI
    SAVELDALRRSEEVLVLDSRTEQEFNLMSVPGAYSCPGAELVARALDHAGPIVVN
    CAGRTRSIIGAQSLRNAGKTDVRAL
    ENGTMGQHLAGLPLERGKSASYLDRPVAAGAAQAAQAWALGMSIATLDAGELHDMLSNPYRTTYLFDARDPSCSSRATLP
    RAVAAPGGQLVQQTDYYAPVRNARIVVFDTDGVQAPMTAGWLHQMGWEVYLHRPEATALVAPPRVEYDDERGVPVEAVAA
    DAVIIDVGDSRTYRAGHLAGAAWAPRSRLPALLAQRKPAGPLLFTCADGRVSRLAAADAAAQGYQAAYLKGGTAALGADR
    LRGDAPQFLTEAIDVWYRPYDRETGIEEAMHQYLSWETGLLDKVRSDPTVAFRI

    >gi|33592121|ref|NP_879765.1| antioxidant protein [Bordetella pertussis Tohama I]
    MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTK
    WIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQL
    TDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK

    >gi|33592145|ref|NP_879789.1| dihydrolipoamide dehydrogenase [Bordetella pertussis Tohama I]
    MSNIVEIKVPDIGDFKEVEVIEVLVAAGDTIKAEQSLITVESDKASMEIPASSAGVVKSVKVKVGDKVAEGTVILDVEAA
    GEAAAAPKAEAPKAEAPKAEAPKADAPKAPAAKASAPAAAAYSGSADLECDMLVLGAGPGGYSAAFRAADLGMDTVMVER
    YATLGGV
    CLNVGCIPSKALLHNAAVIDEARALAAHGISFGEPKVDLDKLRGYKDSVVAKLTGGLAGMARARKVRVVTGTG
    EFADPHHLTVTDGEGKKQTIRFKQAIIAAGSQSVKLPFLPDDERIVDSTGALQLRAIPKKMLIVGGGIIGLEMGTVYSTL
    GARLDVVEMLDGLMQGADRDLVKVWQKMNAPRFDNIMLKTKTVGAEARKDGIYVSFEGEGAPKEPQRYDLVLQAVGRSPN
    GKKIGAERAGVAVTERGFIEVDRQMRTNVPHIYAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKSYFDARVIPSVAYTDPE
    VAWVGLTEDEAKKQGVKVEKGLFPWAASGRAIANGRDEGFTKLLFDAETHRIVGGGIVGTHAGDLISEIALAIEMGADMV
    DIGKTIHPHPTLGESVGMAAEVAEGVCTDLPPMRKK

    >gi|33592228|ref|NP_879872.1| hypothetical protein BP1090 [Bordetella pertussis Tohama I]
    MKWLRLQDLPTDNSFAALPAEFYTRLQPRPPAAPRLLHANAEAAALIGLDPAEFSTQAFLDVFSGHAPLPGGDTLAAVYS
    GHQFGVWAGQLGEVRGPAGGWELQLKGAGMTPYSRMGDGRAVLRSSVREYLASEAMHGLGIPTTRSLALVVSDDPVMRET
    VETAAVVTRMAPSFVRFGSFEHWSARRQPEQLRVLADYVIDRFYPECRVAGAGRLDGEHGEILGLLAAVTRRTALLMADW
    QAVGFCHGVMNTDNMSILGLTLDYGPYGFMDTFQLGHICNHSDSEGRYAWNRQPSVGLWNLYRLASSLHTLAPDPEALRA
    VLDGYEAVFTQAFHGRMAGKLGLPQFLPEDETLLDDLLQLMHQQGADFTLAFRRLGEAVRGQRQPFEDSFIDRAAAGAWY
    DRLAARHASDGRAAQARAAAMDEVNPLYVLRNHLAEQAIRAAARGDAGEIDILLKLLRNPYKHQPGYDAYAGLAPDWAAG
    LEVS
    CSS

    >gi|33592261|ref|NP_879905.1| dihydrolipoamide dehydrogenase [Bordetella pertussis Tohama I]
    MSKQFDVVVIGAGPGGYIAAIRAAQLGMSVACIDAWQNGQGGPAPGGTCTNVGCIPSKALLQSSEHYEQANHHFAEHGIE
    VKGVSLKLDTLIGRKNTVVKQNNDGILYLFKKNKVTYFHGKGAFAGQVDGGWSIKVTGTTDADLVAKHVIVATGSSAREL
    PGLPFDEKNILSNDGALNIGAVPKKLGVIGAGVIGLEMGSVWRRLGAEVTILEAMPEFLAAADQQVAKEALKSFAKQGLD
    IQTGVKIGEIKAAAKSITVPYVDAKGAEQKLVVDKLIVSIGRVPYTGGLNAEAVGLKLDERGFVAVDEDCKTNLPNVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFATVPWVIYTSPEIAWVGKTEQQLKAEGREYKAGSFPFMANGRARALG
    DTTGFAKVIADAKTDEVLGVHIIGPMASELISEAVTIMEFRGAAEDIARICHAHPTLSEAVKEAALAVDKRTLNF

    >gi|33592390|ref|NP_880034.1| thioredoxin 1 [Bordetella pertussis Tohama I]
    MTVVCFNPSYTSNKNSGRMLHARVAQRNPRITIMSEQIKNVSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVA
    AEYAGRLTVAKLNVDENQDTAAKYGVRGIPTLMLFKDGQAAATKVGALSKSQLTAFLDGAL

    >gi|33592424|ref|NP_880068.1| glutathione peroxidase [Bordetella pertussis Tohama I]
    MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGLEELYRSYRNEGFVVLGFPCNQFGRQEPGDEAAIAQ
    FCETQYAISFPLFAKIDVNGAHAHPLYRWLKARKPGLLGTRAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACA
    APGPTP

    >gi|33592428|ref|NP_880072.1| putative arsenate reductase [Bordetella pertussis Tohama I]
    MFHRGVCMSATIYHNPRCSTSRNVLQMLRDAGIEPTIIEYLKTPPSRQTLAGLIQQSGLSVREAVRAKEPIYQELGLDGV
    DDEGLLDAMVDNPILINRPFVITERGARLCRPAESVREILP

    >gi|33592429|ref|NP_880073.1| putative bacterioferritin comigratory protein [Bordetella pertussis Tohama I]
    MSRPALLLAALLSIAAPAAHAALPVGAPAPDFSAQASQGGNTFTFELAQALRQGPVVLYFYPAAFTQGCTIEARNFAEAI
    DQYRALGATVIGVSGDDIETLRKFSVSECRGKFPVAADADGAIMKAYDAVHDRRPEYAQRISYVISPQGRIVYEFTDMSP
    DRHVANTLQALRDWQARKK

    >gi|33592785|ref|NP_880429.1| thioredoxin 2 [Bordetella pertussis Tohama I]
    MSIVELTKDTFQDAITPDGTLIIDFWAPWCGPCRGFAPVFEQAAEQHPDVTFAKVNTDVEQELAGALGIRSIPTLMVFRE
    KVLLFSQPGALSAGQLGELLTKVKEVDMAEVHRDIAQARENGEGEQA

    >gi|33592799|ref|NP_880443.1| putative glutaredoxin [Bordetella pertussis Tohama I]
    MLQNREGQRVPSVTFPVRENNAWKQVTTDDVFKNKTVVVFSLPGAFTPTCSSTHLPRYNELAPTFFAAGVDSIVCVSVND
    TFVMNERAKDQESANVTLLPDGNGEFTDGMGMLVDKKDLGFGKRSWRYAMLVKDGVVEKMFIEPEKEGDPFEVSDADTML
    AYVAPQARKPDQVVVFSKPG
    CPFCVDAKALLKGKGFDPIEIPLDNKVRGRVIGAVSGGDTAPQVFINGKLIGGFDALKAY
    LA

    >gi|33592800|ref|NP_880444.1| dihydrolipoamide dehydrogenase [Bordetella pertussis Tohama I]
    MKTLHTDVAIIGAGTAGLAAHRAARAAGKRALLIEGGQYGTTCARVGCMPSKLLIAAAEAAHAAAHGGPFGVHIDGAVRI
    DGAQVMARVKSERDRFVGFVLEGVENIPAEDKLRGMARFVEDTVLRVDGHTEVRAGSVVIASGSRPAVPPPFLALGDRLV
    VNDDVFAWDTLPARVAVFGPGVIGLELGQALARLGVQVRVFGVSGSLGGITDPRVRQSARKAFQQEFYLDPDARVLETKR
    VGDEVEVRYVALDNTERTERFDYALVATGRRPNVDGLDLHNTSLALDARGVPHFDRHTMQAGQAPVFIAGDANADAPLLH
    EAADEGRIAGENAARYPDVAPGLRRAALGVVFSDPQIALVGTPFARLESGTFVAGEVDFGDQGRSRVMLRNRGMLRVYAD
    IESGRFVGAEMVGPSAEHIGHLLAWAAQQSLTVAQMLEMPFYHPVVEEGLRTALRDAAARLAQARPQRLAA

    >gi|33592863|ref|NP_880507.1| [Fe-S] cluster formation/repair protein [Bordetella pertussis Tohama I]
    MAVTLTQSAANHVGRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAADDVVFDSFGVKVFIDPKSLAYLDGTELDYA
    REGLNEGFRFSNPNEKATCGCGESFTV

    >gi|33593121|ref|NP_880765.1| hypothetical protein BP2106 [Bordetella pertussis Tohama I]
    MITPPDHPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQR
    VRDHLDPGRPLGHIDGRPKP

    >gi|33593132|ref|NP_880776.1| glutathione reductase [Bordetella pertussis Tohama I]
    MAFDFDLYVIGAGSGGVRAARFAAGYGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHFHEDFEQAAGFGWNPGRPEFDW
    PTLIANKNREIERLNGIYRNLLVNSGVALHEGHARIVDPHTVEINGQRHSAQHILVATGGWPFVPDIPGKEHAITSNDAF
    FLPELPRRVLVVGGGYIAVEFASIFDGLGAQTVQVYRRELFLRGFDGSVREHLRDELVKKGLDLRFNTDVERIDKRADGV
    LAVTLSDGSVLETDCVFYATGRRAMLDDLGLENTGVRLAESGYIEVDDEYRTSEPSILAIGDVIGRVPLTPVALAEGMAV
    ARRLFRPQEYRKVDYDLIPTAVFSLPNIGTVGLTTEQALERGFRVTRYESRFRPMKLTLTQSQEKTLMKLVVDADSQKVL
    GCHMVGPDAGEIVQGLAVALKAGATKQVFDDTIGIHPTAAEEFVTMRTAT

    >gi|33593277|ref|NP_880921.1| putative sulfurtransferase [Bordetella pertussis Tohama I]
    MTMTLISAADLTARLDAGGVRVFDVRHDLADHAAGRRAYEQGHIAGARYLDHEAELAAPRSGSNGRHPLPERDAFAGLMA
    AHGVTPETLVVAYDASGGMFAAHLWWMLRWMGHERVAVLDGGWQAWTAAGLPTEAGATPAVSAQPGARAGQSLAGTVDAA
    AVLANIGQPAFTVIDARAANRYRGEVEPMDPVAGHIPGALNRPNTENLQADGRFKAPAQLRQEFEALLGGRAADGIVHQ
    C
    GSGITACHNLLAMEIAGLAGSRLYPGSWSEWCSDAARPVAKGA

    >gi|33593338|ref|NP_880982.1| hypothetical protein BP2344 [Bordetella pertussis Tohama I]
    MKQVTLYGLNKCSTCVKARDWLAARGVAHDFVDYRDHPVPAATLKQWAGKVGGWEKLVNRTSMTWRALSDERKAARSDAE
    WTALIAEYPALVRRPVTVTPDGEVTVGFSEKRYGERFA

    >gi|33593371|ref|NP_881015.1| hypothetical protein BP2382 [Bordetella pertussis Tohama I]
    MTQRLDYQQQSPELFKKFVAFSLALKQSSIETSIRDLVDIRASQINGCTFCLDMHVKEATMHGERPLRLHHIAAWRESTL
    FSPRERAALAWTEVLTRIPAEGISDEIHAQVREQLSEQELSDLTFLVMSINAWNRVNVAFRIEPGKYDQAFGVDKSGLS

    >gi|33593457|ref|NP_881101.1| thioredoxin reductase [Bordetella pertussis Tohama I]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPALITGLAQGGQLMTTTEVDNWPADVQGVQGPDLMQRFLQHAERFNTEI
    LFDHIAKVDLSRRPFTLTGDTGNLYTCDALIIATGASAKYLGLASEQAFMGRGVSG
    CATCDGFFYRNKDVVVIGGGNTAV
    EEALYLSNICRKVTLIHRRDKFRAEPILVDKLMDKVANGNMELKLFHTLDEVLGDDSGVTGVRIRSTETDATEDLDVDGC
    FVAIGHQPNTGIFEGQLEMKDGYIITKSGLSGMATMTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRWLENAGQ

    >gi|33593483|ref|NP_881127.1| putative thioredoxin [Bordetella pertussis Tohama I]
    MAAAPFDPAEVFQVFGMRRVDSASFDEQVVRAPGDDLRCVFLWGQDCYNCGIFKQTALLQRQALLALELSWFEADVYADE
    ALGRRFSLHGVPTFVLYRSGKRLGRVTGWPGLPQFSAAMQRLRDGT

    >gi|33593679|ref|NP_881323.1| AhpC/TSA-family protein [Bordetella pertussis Tohama I]
    MTIKAGDRVPDGTLTEFIETETAGCTLGPNAFQVADLVKGKKIALFAVPGAFTPTCSAKHLPGYVEQAAALRAKGIDEIW
    CVAVNDAFVMGAWGREQQAGGKVRMLADGSALWTTALGLELDLVQRGMGVRSQRYSALIDDGVVKQLNIEAPGKFEVSDA
    ATMLAQA

    >gi|33593743|ref|NP_881387.1| hypothetical protein BP2787 [Bordetella pertussis Tohama I]
    MTPLIGKPAPLFTAESTIGPVSLDQCQGRAVVLYFYPKDNTPGCTTESQDFRDLYEDFLAASTIVLGVSRDSLKSHENFK
    TKYELPFPLISDADETVCNLYGVIKQKNMYGKQVRGIERSTFLIDAYGVLVQEWRGVKVPGHAKEVLQAAKSIG

    >gi|33593893|ref|NP_881537.1| iron-sulfur cluster insertion protein ErpA [Bordetella pertussis Tohama I]
    MNAVTETVDLQAPPPVPLVFTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFDEVVNDDDTVLDKAGVQLLV
    DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV

    >gi|33593930|ref|NP_881574.1| thioredoxin [Bordetella pertussis Tohama I]
    MHCYDRAMNRRLFLYAGVAAAAAASGGYFLAERRNARPAPSVAAPAEGAGDPLAQLRQLALPDLHGTPRKLADWGGQPLV
    VNFWATW
    CAPCVKEMPELDALQKKYPQVRFVGIGVDTTDNMRKFVEKIPVSYPLLVMGAGAIDTLRSLGNPSGGLPFTLL
    LSADGSMKRKILGQIVYDDLDRSVAGLSA

    >gi|33593970|ref|NP_881614.1| methionine sulfoxide reductase A [Bordetella pertussis Tohama I]
    MSSSQPAGAATEAAVLGGGCFWCVEAVFKDLRGVTGIEPGYAGGHVEHPTYEQVCGKDTGHIEVARVEFDPAVLSYGDLL
    RVFFATHDPTTPGRQGNDVGPQYESAIFWQDERQREQAQAVMDELRAQQVFDAPIVTRLLAPAKFWPAEDYHRDYYALHP
    EQGYCQFVIAPKVAKFRKQFQDRLAR

    >gi|33594124|ref|NP_881768.1| hypothetical protein BP3217 [Bordetella pertussis Tohama I]
    MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEER
    KGIYRLTAKLKLHGDLDDAQIDELLKVADK
    CPLHKLMTATDIQVSTIVVE

    >gi|33594170|ref|NP_881814.1| putative thiol:disulphide interchange protein (periplasmic) [Bordetella pertussis Tohama I]
    MSGPSFSGAGMNFRITVWCAAAAVWSSGALAQDGAGQAAPGTPDKVYSTTGSAPAKPGDKVYSTRSAQAPDPQADAVKER
    FAQRFEGFDVTAVRRTPYGLFEVQIGTDLLYTDEKVTWVMEGPLIDALTRRDVTRERQEKLSSVPFEELPLDLAVKQVKG
    DGSRVMAVFEDPN
    CGYCKQLHRTLEDMDNITVYTFLYPILSPDSTTKVRDIWCASDPAKVWKDWMVRGQRPPTAECDAPV
    DQWLALGRQLMVRGTPAIFFKSGGRVSGALPRDELEARL

    >gi|33594278|ref|NP_881922.1| hypothetical protein BP3394 [Bordetella pertussis Tohama I]
    MARPENGYAGYDSQTRCDLPTMPLHVPGSDIPTLRAALARSDAWLVACFCAAWCDTCQQYRPKLLELARARPGHTFAWID
    IEDHPDLLGEEDVENFPTLLVQAHGKVLFYGPMLPHIGHLERLLDSLDPQGRPVATGLPDVARLLAAA

    >gi|33594393|ref|NP_882037.1| hypothetical protein BP3522 [Bordetella pertussis Tohama I]
    MPPVLYCNDPGRASALSLFLHPLRDVIMSINTSTLDLPSALPPIRINHKPLWAALLLVLAGAAYLLQSVGWRQSALWVVG
    ALLGVTLYHASFGFTQAWRVFVSDRRGAGLRAQMVMLAVGVLLFFPFLAQGTLWGQPVSGFVSPPGVSVVLGAFLFGIGM
    QLGGG
    CASGTLFAVGGGNTRMLVTLLFFIVGSVIATANFGWWSALPALPPTSLIKSWGLPGALLANLAVFALIAWTTTVL
    EKRRHGQLISHAARTSRTPSLLQGPWPMVWGGIALVVLNFATLALAGRPWGITSAFALWGAKALDVLGGDVASWAYWSRQ
    QAALAAPVRQDITSVMDIGLMLGALAAASAAGKFAPVWKVPARSLLAAVVGGLLLGYGARLAFG
    CNIGAYFSGILSGSLH
    AWLWLPAAFLGSALGVRLRPWFGLAVEKTPAASSC

    >gi|33594421|ref|NP_882065.1| putative antioxidant protein [Bordetella pertussis Tohama I]
    MEFLSTIKDQLPDWAKDIRLNLDAVIARSTLAPEDALGAALSAAFAARSQLLIDAFKGALSETDANAALTASALMGMNNT
    WYPYVEMTGDAQLKSLPAQLRMNAYATHGGVDKKRFELFALAASIIGKCHF
    CVQSHYENLKKDGLTVEQLRDAGRIAAVV
    NAAALALAAQGK

    >gi|33594422|ref|NP_882066.1| alkyl hydroperoxide reductase [Bordetella pertussis Tohama I]
    MKTVGDKLEPFKVTGVKPGFNQHEENGVSAFEDITESSFPGKWKVIYFYPKDFTFVCPTEIVGFNKLAKDFEDRDAVLLG
    GSTDNEFVKLAWRREHPDLNKLGHYQFGDTTGALIDQLGVREKGAGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLR
    LLDGLQTDELCPCNRSVGGATL

    >gi|33594433|ref|NP_882077.1| methionine sulfoxide reductase B [Bordetella pertussis Tohama I]
    MEKIRKTDAEWRTQLAPEEYAVARQKGTERAFSGRYWDTSTPGIYRCIGCGTPLFASDTKFDAGCGWPSYFEPLAPERVR
    EELDTSHGMVRTEVLCNICDAHLGHVFPDGPEPTGLRY
    CINSLSLKFEPLEDE

    >gi|33594510|ref|NP_882154.1| thiol:disulfide interchange protein [Bordetella pertussis Tohama I]
    MMQYGHASATGHGASATGRAAAAGRWLAWMLALALVLFARPAAALTEDDFLPPEQAFVFSAAMADPATLVLNYRIAPEYY
    MYRERFGLSASPAQAVTLGEAAYPQGKVKYDPTFDKDMEVFYGTVAVRVPLSQGNGQPFTLTVTSQGCADAGLCYPPMDN
    TVQLTPVTGGYALAAGTASAPQGGGTFDSLLEAGDTRLADFIGGGGWLKTAGVFLLLGMLLAFTPCVLPMVPILSSIVLG
    GAQAQRPSRWRGLGLAAAYVFGMSVVYTALGVAAGLSGAGLAAWLQTPWILSLFAILLAVLALAMFGAFTFQMPAGLQAR
    LSERSNRIPGGRVTGALVMGALSALIVGPCVAAPLAGALLYISQTGDVILGGAALFAMAWGMGIPLLLVGASAGTLLPRT
    GPWMESVKRVFGMLLLGTAWWMLIPVVPTWVQMLGWSFLAVVGAVMLRAFDALPAGSGAPRMFAKGLGLLLALAGAAWLI
    GALSGGRDVLAPLSHLAARAPAGGAVAAAGPAAVDKTRFVRVRSNAELDALLARSTQPVMLDFYADW
    CVSCREMEHFTFS
    DPTVAARMSQMLLVQADVTKNNADDRALLKRFRLFGPPGIMFFEPGGKLIEDIRVVGFQDARRFAGVLEQVADRSGAPGP
    AQAGS

    >gi|33592138|ref|NP_879782.1| hypothetical protein BP0988 [Bordetella pertussis Tohama I]
    MYSPLSGRAWRGLLLAMLMLLAACSERSADWSLYNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPT
    TMAQLTAVLQQLGEQARDVRILFVSVDPHRDTPDILQAYVNEFNSNAIGVTGNEKQIADLARRYRVAYQIEKPKPGDDAD
    IYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ