Bordetella parapertussis 12822 uid57615

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|33594782|ref|NP_882425.1| thiol:disulfide interchange protein [Bordetella parapertussis 12822]
    MMQYGHASATGHGASATGRAAAAGRWLAWMLALALVLFARPAAALTEDDFLPPEQAFVFSAAMADPATLVLNYRIAPEYY
    MYRERFGLSASPAQAVTLGEAAYPQGKVKYDPTFDKDMEVFYGTVAVRVPLSQGNGQPFTLTVTSQGCADAGLCYPPMDN
    TVQLTPVAGGYALAAGTASAPQGGGTFDSLLEAGDTRLADFIGGGGWLKTAGVFLLLGMLLAFTPCVLPMVPILSSIVLG
    GAQAQRPSRWRGLGLAAAYVFGMSVVYTALGVAAGLSGAGLAAWLQTPWILSLFAILLAVLALAMFGAFTFQMPAGLQAR
    LSERSNRIPGGRVTGALVMGALSALIVGPCVAAPLAGALLYISQTGDVILGGAALFAMAWGMGIPLLLVGASAGTLLPRT
    GPWMESVKRVFGMLLLGTAWWMLIPVVPTWVQMLGWSFLAVVGAVMLRAFDALPAGSGAPRMFAKGLGLLLALAGAAWLI
    GALSGGRDVLAPLSHLAARAPAGGAVAAAGPAAVDKTRFVRVRSNAELDALLARSTQPVMLDFYADW
    CVSCREMEHFTFS
    DPTVAARMSQMLLVQADVTKNNADDRALLKRFRLFGPPGIMFFEPGGKLIEDIRVVGFQDARRFAGVLEQVADRSGAPGP
    AQAGS

    >gi|33595007|ref|NP_882650.1| glutaredoxin 3 [Bordetella parapertussis 12822]
    MPAIPSPPGATMQKVVMYSKDYCPYCARAQALLKQRGVADLEIIRIDQDPSQRDIMIERTGRRTVPQIFIGETHVGGSDD
    LQALDRSGGLLPLLNGG

    >gi|33595008|ref|NP_882651.1| hypothetical protein BPP0294 [Bordetella parapertussis 12822]
    MDLLQFLIDKNNVFIVAVAVVSGIMLMLPALRKGRAGAAVGTSEAIQMVNQRQAVWVDVRPTEQFQAGHIAQARRLPAAD
    LEKKAGALPKNKPLIVV
    CEQGRDAARIAARLRSQGFAEVSVLEGGMRAWFAAGLPVTQKG

    >gi|33595012|ref|NP_882655.1| adenylyltransferase [Bordetella parapertussis 12822]
    MNDQQLLRYARHILLDELGIEGQERFLAARVLIIGAGGLGCPAALYLATAGVGHITLVDDDVVELSNLQRQILHASDSVG
    RAKAESGRDMLARFNPETQVEARVERLAGAALDTAVAQADVVLDCSDNFATRHAINRACVRHRKPLVSGAAIRFDGQVSV
    YDLRDAQAPCYHCLFPEADDVEELN
    CATTGVFAPLVGIIGSVQAAEALKLLAGIGQSLAGRLLQLDVRSMQWHSVNVPRD
    PDCAVCGQGGQAAEHARGDAAHCA

    >gi|33595095|ref|NP_882738.1| hypothetical protein BPP0384 [Bordetella parapertussis 12822]
    MSDVQEFIRETVTQHPVVLFMKGTAQFPQCGFSGRAIQILKGCGVKKLVTVNVLEDDEVRQAIKTFSNWPTIPQLYVGGE
    FIGGSDIMSEMNESGELKQLLDDSGATA

    >gi|33595166|ref|NP_882809.1| carboxymuconolactone decarboxylase [Bordetella parapertussis 12822]
    MLDWNQYRSELMTRIGEIAKASPETVKGYQQLSAAGKQTNQLDAKTRELIALAVAVTTRCDGCIAVHAKAATDNGATKGE
    IAEALGVAVALNAGAALVYSARVMDAVDAAQ

    >gi|33595239|ref|NP_882882.1| putative sulfurtransferase [Bordetella parapertussis 12822]
    MSEVVSAQWLRQRLESGAECAVVDPREEGAHSVSPHLFHAVNLPLSQLELRVERLFPRRDVPIVVAGAGDALDERARRRL
    QELGYAGAVRLEGGSPAWAGLGLPLFTGFNTASKAFGEYVEHGCATPSISADELREMVASGRPLVIVDSRTPAEHRRATI
    PGSVSAPGAELVLRYAELAPDPHTTLVVN
    CAGRTRSIIGAQSLINAGVPNPVFALRNGTMGWALAGHKVETQSARQAPEP
    GAATLALAQQRAAAVRRRFGIGEIGAAELQRLRAGGERTVYLFDVRTQQEYERGHVPGAVHAPGGQLVQATDSYVAVRNA
    RIVLYDHHGVRDVMTGSWLRQMGHEDVVTLRADAVSAAQLAAGPQAVRVAGLDGARARRLAPAEAAGSLAQYTVVDVGAY
    RDYQAGHLPQAYWVTRARLAEALDGLPADRPLLLVSPDALLAQLACADVAASAARPVYVLEGGMARWRAEGRPVEEGDGR
    PLHEPDDAFVKPFEARDRELSMQAYLDWEVGLLDAVQRHPAIRFDLYKE

    >gi|33595675|ref|NP_883318.1| hypothetical protein BPP0998 [Bordetella parapertussis 12822]
    MTMRIDYNQVAPGAAAALAGVYGYVMKSGLAPALVELVYLRVSQINNCAYCLDMHTRDLLNQGVAVEKLALLQAWREAGG
    LFDARERAALAWAESVTQAAQTGVPDQDYQDARAVFGEKELVDLTVAIGLMNAYNRMAIGFRNTPKAAV

    >gi|33595697|ref|NP_883340.1| O6-methylguanine-DNA methyltransferase [Bordetella parapertussis 12822]
    MNLPVRPAPAYATPEARWAAVQARDPAADSHFVYAVRTTGVYGRPSSAARLPRRENVEFFDNAEAARAAGYRPSRHNAAD
    RTVTARQHSALVAAACRHIEQADTPPTLEALAAHVGLSPFHLHRLFKAETGLTPKAYASAQRARRLRAELGESASVTAAI
    YDAGFNSNSRFYEASQQLLGMAPRAYRAGGANARIRFAVAQCALGAILVAQSQLGICAILLDDDPDYLVRQLQDLFPRAT
    LIGGDAGFERLVAEVVGFVEAPALGLNLPLDVRGTAFQERVWQALREVPPGATVSYTDIAERIGAPKAVRAVAQACAANR
    IAVAIP
    CHRVVRRDGDLSGYRWGVDRKRELLRREAATP

    >gi|33595793|ref|NP_883436.1| AhpC/TSA-family protein [Bordetella parapertussis 12822]
    MPRPFGRTSPEKPESLMTIKVGDRVPDGTLTEFIETETAGCTLGPNAFQVADLVKGKKIALFAVPGAFTPTCSAKHLPGY
    VEQAAALRAKGIDEIWCVAVNDAFVMGAWGREQQAGGKVRMLADGSALWTTALGLELDLVQRGMGVRSQRYSALIDDGVV
    KQLNIEAPGKFEVSDAATMLAQA

    >gi|33595920|ref|NP_883563.1| putative thiol:disulfide interchange protein [Bordetella parapertussis 12822]
    MSAMVQLGPLMLPTALLLMLACVAAGSLAARWQAGSAGAGEMPLMRVLLAGLLAARLAFVWRHREAYLQSPWDVLDIRDG
    GWLAWAGFAGAWACGLWFARRRGPRRRPLLAGLAAATLAWTVGAAVLGIGAPAAIKAMPPLQLATPDGAPRSLAAFAGQP
    VVLNLWASW
    CPPCRREMPMLQRMQAARPDVHFVFVNQGESAQQVNAYLRELGMPLRNVLLDPGAQAGAYFGHRALPATLF
    FDAQGRLVDTRLGELSQASLVQRLGALRPAP

    >gi|33595921|ref|NP_883564.1| disulfide isomerase/thiol-disulfide oxidase [Bordetella parapertussis 12822]
    MSDPILPRAAAGLRCACAVLAGAVLAAGAAQAQQPPAPVAALAQHGIEILGTFPAPGGLTAWAAHAGDRPVALYATPDGK
    HVIVGTMFDAEGRDVTQAALEQAIEPALSDKLWSALEQSAWVADGKAGAARIVYVFTDPN
    CPYCNKLWADARPWVEAGKV
    QLRHIPVGILTASSEGKAAAILAAPDPAKALHDHEAGHVASNTRALAAGERKPLDERGIQPLADIPAEIAARLNANETLM
    AQWGLRATPAIVWREQGGRVRKRTGAPPALLPQLFGAL

    >gi|33596017|ref|NP_883660.1| glutathione reductase [Bordetella parapertussis 12822]
    MAFDFDLYVIGAGSGGVRAARFAAGYGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHFHEDFEQAAGFGWNPGRPEFDW
    PTLIANKNREIERLNGIYRNLLVNSGVALHEGHARIVDPHTVEINGQRHSAQHILVATGGWPFVPDIPGKEHAITSNDAF
    FLPELPRRVLVVGGGYIAVEFASIFNGLGAQTVQVYRRELFLRGFDGSVREHLRDELVKKGLDLRFNTDVERIDKRADGV
    LAVTLSDGSVLETDCVFYATGRRAMLDDLGLENTGVRLAESGYIEVDDEYRTSEPSILAIGDVIGRVPLTPVALAEGMAV
    ARRLFRPQEYRKVDYDLIPTAVFSLPNIGTVGLTTEQALEHGFRVTRYESRFRPMKLTLTQSQKKTLMKLVVDADSQKVL
    GCHMVGPDAGEIVQGLAVALKAGATKQVFDDTIGIHPTAAEEFVTMRTAT

    >gi|33596023|ref|NP_883666.1| putative thioredoxin [Bordetella parapertussis 12822]
    MDQIELTDGTADRYLLDAPGLSLLVFHSRTCATCGVARQRLPEFDLPVDRLCWIDAGENGGLVQRYEVFHLPALFVTRDG
    AYYGPVSAQLADWDLRQQISLALDSYPAELP

    >gi|33596062|ref|NP_883705.1| hypothetical protein BPP1405 [Bordetella parapertussis 12822]
    MSRVLLIDPSQAGAERQAILAQIQGAFGATPNMFKAVANSAAALKSMWEAFGALGGGVIAARLGEQIAVAVANRNRCEYC
    LAAHTALGRKAGASAGDMAAAQDGRSADPRTAAALRFALQLVEARGQVGEAEVQAVRAAGFSDEEIVEILAHVALNLFTN
    YVNVAFAVPVDFPKVALRQAA

    >gi|33596063|ref|NP_883706.1| hypothetical protein BPP1406 [Bordetella parapertussis 12822]
    MSRHEALATVTAPPLQVDAWLNTPHPLELARLRGQVVVLHAFQMLCPGCLAHGLPQAERLHRLFRDDGVVVIGLHTVFEH
    HAVMGPEALRVFNHEYRWSFPIGIDRPDPEGDMPMTMRAYSLGGTPSLVLLDRRGRIRLHHLGRLDDLALGAAIGRLLAE
    DAEPAGAPPA

    >gi|33596083|ref|NP_883726.1| hypothetical protein BPP1426 [Bordetella parapertussis 12822]
    MITPPDHPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQR
    VRDHLDPGRPLGHIDGRPKP

    >gi|33596087|ref|NP_883730.1| putative membrane transport ATPase [Bordetella parapertussis 12822]
    MPSTTRDLALDTPSGQRTDAHGHDHAGHDHAGHDHAHDHGIPACCGHGHGQPAAPAAAPAWQPGPGQQVTRVRIGQMDCP
    TEETLIRKKLASLPEVHELDFNLMQRVLTVLHADGALDRIDAAIRSLGMTPEPLAGDAPATPAGAAAPSRGWRLLAAGGV
    LAALSELAHFTGQPVYVAAALALAAILACGLSTYRKGWIAVRNGNLNINALMSIAVTGAMLIGQWPEAAMVMFLFNVAEL
    IEARALDRARHAVRGLLDLAPQTATARQPDGSWAEVPAARLRPGDLVRVRPGERIAADGTISEGHSAIDQSPITGESLPV
    EKGPDDDVYAGTVNASGSFDYRVTAAAGNTTLDRIIHAVEQAQGARAPTQRFIDRFSRIYTPAVVGLAVLVALAPPPLLL
    GHAWLDSVYRALALLIIACPCALVISTPVSVVSGLTAAARRGILIKGGVYLEEGRKLRWLALDKTGTLTQGKPVQTDLEL
    LHDASAGGRPALRAAVSLAARSDHPVSRALAQADHALDAPLDEVNGFAALPGRGVQGEIGGERFQLGNRRLMRELGVSTP
    DIEARIDAYEAAGKTAIALADGQRVLLLAAVADTLKASSAAAVADLHRLGVRTLMLTGDNTRAAQAVAAQAGIDEARGDL
    LPQDKLDAVEAKLDPALRVGMVGDGINDAPALARADIGFAMGAAGTGTAIETADVALMDDDLRKIGTFVRLSRATHRILT
    QNIVLALGIKAVFLVLAMAGQATLWMAVFADVGASLLVVANGLRLLRAGRHQAS

    >gi|33596119|ref|NP_883762.1| dihydrolipoamide dehydrogenase [Bordetella parapertussis 12822]
    MSNIVEIKVPDIGDFKEVEVIEVLVAAGDTIKAEQSLITVESDKASMEIPASSAGVVKSVKVKVGDKVAEGTVILDVEAA
    GEAAAAPKAEAPKAEAPKADAPKAPAAKASAPAAAAYSGSADLECDMLVLGAGPGGYSAAFRAADLGMDTVMVERYATLG
    GV
    CLNVGCIPSKALLHNAAVIDEARALAAHGISFGEPKVDLDKLRGYKDGVVAKLTGGLAGMARACKVRVATGTGEFADP
    HHLTVTDGEGKKQTIRFKQAIIAAGSQSVKLPFLPDDERIVDSTGALQLRAIPKKMLIIGGGIIGLEMGTVYSTLGARLD
    VVEMLDGLMQGADRDLVKVWQKMNAPRFDNIMLKTKTVGAEARKDGIYVSFEGEGAPKEPQRYDLVLQAVGRSPNGKKIG
    AERAGVAVTERGFIEVDRQMRTNVPHIYAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKSFFDARVIPSVAYTDPEVAWVG
    LTEDEAKKQGVKVEKGLFPWAASGRAIANGRDEGFTKLLFDAETHRIVGGGIVGTHAGDLISEIALAIEMGADMVDIGKT
    IHPHPTLGESVGMAAEVAEGVCTDLPPMRKK

    >gi|33596327|ref|NP_883970.1| hypothetical protein BPP1695 [Bordetella parapertussis 12822]
    MKQVTLYGLNKCSTCVKARDWLAARGVAHDFVDYRDHPVPAATLKQWAGKVGGWEKLVNRTSMTWRALSDERKAARSDAE
    WTALIAEYPALVRRPVTVTPDGEVTVGFSEKRYGERFA

    >gi|33596499|ref|NP_884142.1| thioredoxin 1 [Bordetella parapertussis 12822]
    MTVVCFNPSYTSNKNSGRMLHARVAQRNPRITIMSEQIKNVSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVA
    AEYAGRLTVAKLNVDENQDTAAKYGVRGIPTLMLFKDGQAAATKVGALSKSQLTAFLDGAL

    >gi|33596537|ref|NP_884180.1| hypothetical protein BPP1919 [Bordetella parapertussis 12822]
    MKWLRLQDLPTDNSFAALPAEFYTRLQPRPPAAPRLLHANAEAAALIGLDPAEFSTQAFLDVFSGHAPLPGGDTLAAVYS
    GHQFGVWAGQLGDGRAHLLGEVRGPAGGWELQLKGAGMTPYSRMGDGRAVLRSSVREYLASEAMHGLGIPTTRSLALVVS
    DDPVMRETVETAAVVTRMAPSFVRFGSFEHWSARRQPEQLRVLADYVIDRFYPECRVAGAGRLDGEHGEILGLLAAVTRR
    TALLMADWQAVGFCHGVMNTDNMSILGLTLDYGPYGFMDTFQLGHICNHSDSEGRYAWNRQPSVGLWNLYRLASSLHTLA
    PDPEALRAVLDGYEAVFTQAFHGRMAGKLGLPQFLPEDETLLDDLLQLMHQQGADFTLAFRRLGEAVRGQRQPFEDLFID
    RAAAGAWYDRLAARHASDGRAAQARAAAMDEVNPLYVLRNHLAEQAIRAAARGDAGEIDILLKLLRNPYKQQPGYDAYAG
    LAPDWAAGLEVS
    CSS

    >gi|33596587|ref|NP_884230.1| osmotically inducible protein C [Bordetella parapertussis 12822]
    MKKTASAVWKGDLKSGQGTISSQSGALKNQPYGFNTRFADQPGTNPEELLGAAHAGCFSMALSNILGEAGLKADSIETTA
    EVTLDKTDDGFTITAVHLTVNAVVPGATKDSFADAAAKAKAG
    CPVSKVLNARISMDATLKG

    >gi|33596645|ref|NP_884288.1| [Fe-S] cluster formation/repair protein [Bordetella parapertussis 12822]
    MAVTLTQSAANHVGRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAADDVVFDSFGVKVFIDPKSLAYLDGTELDYA
    REGLNEGFRFSNPNEKATCGCGESFTV

    >gi|33596758|ref|NP_884401.1| putative transferase [Bordetella parapertussis 12822]
    MPSIHPIPPTVADMHFINAQTLKSWLHDGAEIALFDVREHGQYGESHLFHGITLPYSRLEADVQRLAPRRQVRLVVYDDG
    QGIAQAAARRLAALGYGDVHVLEGGTPAWQAAGYALFAGVNVPSKTFGELVEQVYDTPHVTAAELDAMLGAGEDVVVLDG
    RPYAEYRKMAIPGATYCPNGELAYRVGKLVPSDKTRIVIN
    CAGRTRSIIGAQTLINLGLPNPVAALQSGTQGWMLADLEL
    EHGASRRYGGPSDDIEAARGAAEALARRYEVPMVDAETVRGWARDGQRTVFLCDVRTPEEYAAGTLAGAQHTPGGQLIQA
    TDQYVGVRRARLVLFDADGVRARVVASWLCQMGHEAYVLEGGLASGLALPAPAPALPRPDEIDAATLAAWLDEGRPLALV
    DVGASMRYRQAHIAQSRWSIRPLLAAALAGCAEPVVLVADEPGVAACAAAELAVLGVPARVLAGGLQAWIDAGLPVQSSP
    DIPPDEACVDYLFFVHDRHSGNKAAARQYLEWEVNLISQLDERELGEFRLPRR

    >gi|33597036|ref|NP_884679.1| putative sulfurtransferase [Bordetella parapertussis 12822]
    MTMTLISAADLAARLDAGGVRVFDVRHDLADHAAGRRAYEQGHIAGARYLDHEAELAAPRSGSNGRHPLPERDAFAGLMA
    AHGVTPETLVVAYDASGGMFAAHLWWMLRWMGHERVAVLDGGWQAWTAAGLPTEAGATPAVSAQPGARAGQSLAGTVDAA
    AVLANIGQPAFTVIDARAANRYRGEVEPMDPVAGHIPGALNRPNTENLQADGRFKAPAQLRQEFEALLGGRAADGIVHQ
    C
    GSGITACHNLLAMEIAGLAGSRLYPGSWSEWCSDAARPVAKGA

    >gi|33597064|ref|NP_884707.1| hypothetical protein BPP2476 [Bordetella parapertussis 12822]
    MTPLIGKPAPLFTAESTIGPVSLDQCQGRAVVLYFYPKDNTPGCTTESQDFRDLYEDFLAASTIVLGVSRDSLKSHENFK
    TKYELPFPLISDADETVCNLYGVIKQKNMYGKQVRGIERSTFLIDAYGVLVQEWRGVKVPGHAKEVLQAAKSIG

    >gi|33597112|ref|NP_884755.1| hypothetical protein BPP2526 [Bordetella parapertussis 12822]
    MPPVLYCNDPGRASALSLFLHPLRDVIMSINTSTLDLPSALPPIRINHKPLWAALLLVLAGAAYLLQSVGWRQSALWVVG
    ALLGVTLYHASFGFTQAWRVFVSDRRGAGLRAQMVMLAVGVLLFFPFLAQGTLWGQPVSGFVSPPGVSVVLGAFLFGIGM
    QLGGG
    CASGTLFAVGGGNTRMLVTLLFFIVGSVIATANFGWWSALPALPPTSLIKSWGLPGALLANLAVFALIAWTTTVL
    EKRRHGQLISHAARTSRTPSLLQGPWPMVWGGIALVVLNFATLALAGRPWGITSAFALWGAKALDALGGDVASGAYWSRQ
    QAALAAPVRQDITSVMDIGLMLGALAAASAAGKFAPVWKVPARSLLAAVVGGLLLGYGARLAFG
    CNIGAYFSGILSGSLH
    AWLWLPAAFLGSALGVRLRPWFGLAVEKTPAASSC

    >gi|33597266|ref|NP_884909.1| cytochrome C-type biogenesis protein [Bordetella parapertussis 12822]
    MLRYLLPLAAFLAMAAFLALGLGRDPRALPSAMLDKPAPPIGLPLLQGDGRRLEVAQLRGRVWVLNVWASWCAPCREELP
    LLQEVGPRDAVPIYGLNYKDKPEDARAWLARHGNPYVASASDVDGRVGIEYGVYGVPETFVIDGAGRIRYRQLGVLTPQI
    WRERLLPVIEGLR

    >gi|33597287|ref|NP_884930.1| arsenate reductase [Bordetella parapertussis 12822]
    MHQQRCVMTSITIYHNPACATSRNVLGLIRNSGEEPAIIEYLKTPPDAATLRSLIVAMGMPVRDLLRQKGTPYDELGLSD
    PKWTDEQLIDLMLQYPILINRPIVTTPLGTRLCRPSETVLDLLSRPQRGAFDKEDGQPVIDADGNRV

    >gi|33597462|ref|NP_885105.1| putative bacterioferritin comigratory protein [Bordetella parapertussis 12822]
    MSRPALLLAALLSIAAPAAHAALPVGAPAPDFSAQASQGGNTFTFELAQALRQGPVVLYFYPAAFTQGCTIEARNFAEAI
    DQYRALGATVIGVSGDDIETLRKFSVGECRGKFPVAADADGAIMKAYDAVHDRRPEYAQRISYVISPQGRIVYEFTDMSP
    DRHVANTLQALRDWQARKK

    >gi|33597463|ref|NP_885106.1| putative arsenate reductase [Bordetella parapertussis 12822]
    MSATIYHNPRCSTSRNVLQMLRDAGIEPTIIEYLKTPPSRQTLAGLIQQSGLSVREAVRAKEPIYQELGLDGVDDEGLLD
    AMVDNPILINRPFVVTERGARLCRPAESVREILP

    >gi|33597467|ref|NP_885110.1| glutathione peroxidase [Bordetella parapertussis 12822]
    MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGLEELYRSYRNEGFVVLGFPCNQFGRQEPGDEAAIAQ
    FCETQYAISFPLFAKIDVNGAHAHPLYRWLKAHKPGLLGTRAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACA
    APGPTP

    >gi|33597483|ref|NP_885126.1| glutathione S-transferase [Bordetella parapertussis 12822]
    MKLYYMAGACSLAAHIVLEWIGKPYETHALSREALKEPAFLKINPLGAVPALTEGDWALTQNAAILEYLAEQAPQLNLLG
    DGSARSRAEVRRWLGFINSDVHKTFSAVFGPQRFVADAAAQEEVRASAAAMLRGLFGQLDTHLQGRSFLAGARPSIADAY
    LYVVLRWAHGKQIDLSGQDNLAAFFERMQADPAVQAALKAEGLS

    >gi|33597583|ref|NP_885226.1| dihydrolipoamide dehydrogenase [Bordetella parapertussis 12822]
    MKTLHTDVAIIGAGTAGLAAYRAARAAGKRALLIEGGQYGTTCARVGCMPSKLLIAAAEAAHAAAHGGPFGVHIDGAVRI
    DGAQVMARVKSERDRFVGFVLEGVENIPAEDKLRGMARFVEDTVLRVDGHTEVRAGSVVIASGSRPAVPPPFLALGDRLV
    VNDDVFAWDTLPARVAVFGPGVIGLELGQALARLGVQVRVFGVSGSLGGITDPRVRQSARKAFQQEFYLDPDARVLETKR
    VGDEVEVRYVALDNTECTERFDYALVATGRRPNVDGLDLHNTSLALDARGVPHFDRHTMQAGQAPVFIAGDANADAPLLH
    EAADEGRIAGENAARYPDVAPGLRRAALGVVFSDPQIALVGTPFARLESGTFVAGEVDFGDQGRSRVMLRNRGMLRVYAD
    IESGRFVGAEMVGPSAEHIGHLLAWAAQQSLTVAQMLEMPFYHPVVEEGLRTALRDAAARLAQARPQRLAA

    >gi|33597584|ref|NP_885227.1| putative glutaredoxin [Bordetella parapertussis 12822]
    MLQNREGQRVPSVTFPVRENNAWKQVTTDDVFKNKTVVVFSLPGAFTPTCSSTHLPRYNELAPAFFAAGVDSIVCVSVND
    TFVMNEWAKDQESANVTLLPDGNGEFTDGMGMLVDKKDLGFGKRSWRYAMLVKDGVVEKMFIEPEKEGDPFEVSDADTML
    AYVAPQARKPDRVVVFSKPG
    CPFCVDAKALLKGKGFDPIEIPLDNKVRGRVIGAVSGGDTAPQVFINGKLIGGFDALKAY
    LA

    >gi|33597598|ref|NP_885241.1| thioredoxin 2 [Bordetella parapertussis 12822]
    MSIVELTKDTFQDAITPDGTLIIDFWAPWCGPCRGFAPVFEQAAEQHPDVTFAKVNTDVEQELAVALGIRSIPTLMVFRE
    KVLLFSQPGALSAGQLGELLTKVKEVDMAEVHRDIAQARENGEGEQA

    >gi|33597648|ref|NP_885291.1| antioxidant protein [Bordetella parapertussis 12822]
    MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTK
    WIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQL
    TDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK

    >gi|33597741|ref|NP_885384.1| dihydrolipoamide dehydrogenase [Bordetella parapertussis 12822]
    MSKQFDVVIIGAGPGGYIAAIRAAQLGMSVACIDAWQNGQGGPAPGGTCTNVGCIPSKALLQSSEHYEQANHHFAEHGIE
    VKGVSLKLDTLIGRKNTVVKQNNDGILYLFKKNKVTYFHGKGAFAGQVDGGWSIKVTGTTDADLVAKHVIVATGSSAREL
    PGLPFDEKNILSNDGALNIGAVPKKLGVIGAGVIGLEMGSVWRRLGAEVTILEAMPEFLAAADQQVAKEALKSFAKQGLD
    IQTGVKIGEIKAAAKSITVPYVDAKGAEQKLVVDKLIVSIGRVPYTGGLNAEAVGLKLDERGFVAVDEDCKTNLPNVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFATVPWVIYTSPEIAWVGKTEQQLKAEGREYKAGSFPFMANGRARALG
    DTTGFAKVIADAKTDEVLGVHIIGPMASELISEAVTIMEFRGAAEDIARICHAHPTLSEAVKEAALAVDKRTLNF

    >gi|33597772|ref|NP_885415.1| hypothetical protein BPP3248 [Bordetella parapertussis 12822]
    MTQRLDYQQQSPELFKKFVAFSLALKQSSIETSIRDLVDIRASQINGCTFCLDMHVKEATMHGERPLRLHHIAAWRESTL
    FSPRERAALAWTEVLTRIPAEGISDEIHAQVREQLSEQELSDLTFLVMSINAWNRVNVAFRIEPGKYDQAFGVDKSGLS

    >gi|33597872|ref|NP_885515.1| methionine sulfoxide reductase B [Bordetella parapertussis 12822]
    MEKIRKTDAEWRTQLTPEEYAVARQKGTERAFSGRYWDTSTPGIYRCIGCGTPLFASDTKFDAGCGWPSYFEPLAPERVR
    EELDTSHGMVRTEVLCNICDAHLGHVFPDGPEPTGLRY
    CINSLSLKFEPLEDE

    >gi|33597884|ref|NP_885527.1| alkyl hydroperoxide reductase [Bordetella parapertussis 12822]
    MKTVGDKLEPFKVTGVKPGFNQHEENGVSAFEDITESSFPGKWKVIYFYPKDFTFVCPTEIVGFNKLAKDFEDRDAVLLG
    GSTDNEFVKLAWRREHPDLNKLGHYQFGDTTGALIDQLGVREKGAGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLR
    LLDGLQTDELCPCNRSVGGATL

    >gi|33597885|ref|NP_885528.1| putative antioxidant protein [Bordetella parapertussis 12822]
    MEFLSTIKDQLPDWAKDIRLNLDAVIARSTLAPEDALGAALSAAFAARSQLLIDAFKGALSETDANAALTASALMGMNNT
    WYPYVEMTGDAQLKSLPAQLRMNAYATHGGVDKKRFELFALAASIIGKCHF
    CVQSHYENLKKDGLTVEQLRDAGRIAAVV
    NAAALALAAQGK

    >gi|33597930|ref|NP_885573.1| hypothetical protein BPP3412 [Bordetella parapertussis 12822]
    MTTMQQRYDAVKDAMAQIGRLAAQLDGEALREAIGPVLVALGERDELFPRDEFPIRAGKPGGLYQLWRGESGDLALYASA
    GKTGKKQPPHDHTTWAVIAGVYGEEHNVFFERTDDGSRAGFGTLRQIDALTVVQGNAARLSGEVFHTIEVVSEEDSLHLH
    LHLYGRALDTLSGRINFATEEGGAYTRFMAVPETYAPWIAPRDLYEMLTDGGELAILDVRENGVYTQGHLFHAASMPLSV
    FELRVDDGLPSPHVRIVVIDDADGLAEQAVRLLHQRGYHNVAVLQGGQPGWNAAGLPVYTGVFVPSKAFGEVAEHVYGTP
    SISAVELDALRRSEEVLVLDSRTEQEFNLMSVPGAYSCPGAELVARALDHAGPIVVN
    CAGRTRSIIGAQSLRNAGKTDVR
    ALENGTMGQHLAGLPLERGKSASYLDRPVAAGAAQAAQAWALGMSIATLDAGELHDMLSNPYRTTYLFDARDPSCSSRAT
    LPRAVAAPGGQLVQQTDYYAPVRNARIVVFDTDGVQAPMTAGWLHQMGWEVYLHRPEATALVAPPRVEYDDERGVPVEAV
    AADAVIIDVGDSRTYRAGHLAGAAWAPRSRLPALLAQRKPAGPLLFTCADGRVSRLAAADAAAQGYQAAYLKGGTAALGA
    DRLRGDAPQFLTEAIDVWYRPYDRETGIEEAMHQYLSWETGLLDKVRSDPTVAFRI

    >gi|33597980|ref|NP_885623.1| thioredoxin reductase [Bordetella parapertussis 12822]
    MGVILKIPAMSTPKHAKVLILGSGPAGYTAAVYAARANLSPALITGLAQGGQLMTTTEVDNWPADVQGVQGPDLMQRFLQ
    HAERFNTEILFDHVAKVDLSRRPFTLTGDTGNLYTCDALIIATGASAKYLGLASEQAFMGRGVSG
    CATCDGFLYRNKDVV
    VIGGGNTAVEEALYLSNICRKVTLIHRRDKFRAEPILVDKLMDKVANGNMELKLFHTLDEVLGDDSGVTGVRIRSTETDA
    TEDLDVAGCFVAIGHQPNTGIFEGQLEMKDGYIITKSGLSGMATMTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQ
    RWLENAGQ

    >gi|33598003|ref|NP_885646.1| putative thioredoxin [Bordetella parapertussis 12822]
    MAAAPFDPAEVFQVFGMRRVDSASFDEQVVQAPGDDLRCVFLWGQDCYNCGIFKQTALLQRQALLALELSWFEADVYADE
    ALGRRFSLHGVPTFVLYRSGKRLGRVTGWPGLPQFSAAMQRLRDGT

    >gi|33598064|ref|NP_885707.1| hypothetical protein BPP3547 [Bordetella parapertussis 12822]
    MARPENGYAGYDSQTRCDLPTMPLHVPGSDIPTLRAALARSDAWLVACFCAAWCDTCQQYRPKLLELARARPGHTFAWID
    IEDHPDLLGEEDVENFPTLLVQAHGKVLFYGPMLPHIGHLERLLDSLDPQGRPVATGLPDVARLLAAA

    >gi|33598278|ref|NP_885921.1| methionine sulfoxide reductase A [Bordetella parapertussis 12822]
    MSSSQPAGPATEAAVLGGGCFWCVEAVFKDLRGVTGIEPGYAGGHVEHPTYEQVCGKDTGHIEVARVEFDPAVLSYGDLL
    RVFFATHDPTTPGRQGNDVGPQYESAIFWQDERQREQAQAVMDELRAQQVFDAPIVTRLLAPAKFWPAEDYHRDYYALHP
    EQGYCQFVIAPKVAKFRKQFQDRLAR

    >gi|33598348|ref|NP_885991.1| hypothetical protein BPP3839 [Bordetella parapertussis 12822]
    MTIQVRANTPGGLQYTAIAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEER
    KGIYRLTAKLKLHGDLDDAQIDELLKVADK
    CPLHKLMTATDIQVSTIVVE

    >gi|33598389|ref|NP_886032.1| iron-sulfur cluster insertion protein ErpA [Bordetella parapertussis 12822]
    MNAVTETVDLQAPPPVPLVFTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFDEVVNDDDTVLDKAGVQLLV
    DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV

    >gi|33598426|ref|NP_886069.1| thioredoxin [Bordetella parapertussis 12822]
    MNRRLFLYAGVAAAAAASGGYFLAERRNARPAPSAAAPAEGAGDPLAQLRQLALPDLQGTPRKLADWGGQPLVVNFWATW
    CAPCVKEMPELDALQKKYPQVRFVGIGVDTADNMRKFVEKIPVSYPLLVMGAGAIDTLRSLGNPSGGLPFTLLLSADGSM
    KRKILGQIVYDDLDRSVAGLSA

    >gi|33598542|ref|NP_886185.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella parapertussis 12822]
    MNPPSAQATDILYCDTDTPLGPMRLAARGQALCGAWFVDQRDCPAAAGWTPDAAHPALRQAAAELEQWFAGRRRAFEVDM
    QPEGTPFQRQVWQALLELPFGATISYGELARRVGRPKAARAVAGAVGRNPISILIP
    CHRIIGHDTSLTGFGGGLPRKQAL
    LAHEGHRYLSRAARARRVSTTQMELPFGAA

    >gi|33598547|ref|NP_886190.1| putative thioredoxin [Bordetella parapertussis 12822]
    MKKIALVLIIAVAAGIGGWFMWRPAQTAPDVAFTTLEGQKITMQDLRGKVVLVKFWATSCVTCVKQMPDNIANYNQYHPQ
    GYETIAVAMNYDPPNYVLNFAQTRKLPFPVALDTSGELAQAFGNVRLTPTAFLIDKQGQIIKRYLGEYDKAEFQATVQKA
    LAG

    >gi|33598640|ref|NP_886283.1| putative thiol:disulphide interchange protein (periplasmic) [Bordetella parapertussis 12822]
    MSGPPFSGAGMNFRITVWCAAAAVWSSGALAQDGAGQAAPGTPDKVYSTTGTAPAKPGDKVYSTRSAQAPDPQADAVKER
    FAQRFEGFDVTAVRRTPYGLFEVQIGTDLLYTDEKVTWVMEGPLIDALTRRDVTRERQEKLSSVPFDELPLDLAVKQVKG
    DGSRVMAVFEDPN
    CGYCKQLHRTLEDMDNITVYTFLYPILSPDSTTKVRDIWCASDPAKVWKDWMVRGQRPPTAECDAPV
    EQWLALGRQLMVRGTPAIFFKSGGRVSGALPRDELEARL

    >gi|33598681|ref|NP_886324.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella parapertussis 12822]
    MRGTRAPHTVKAPSNQERIMHFFQAQLESPLGALSLVTDDRQQVRALEFADSPQRLRRLLHLHYGTCTLREAPAPAAIAA
    ALAHYFSGQCDALDGIATATGGSALQQRVWQALRRIPVGEVTSYGALARQLGHDDRQAARAIGGANAANPIALIVP
    CHRV
    IGKDGALKGYAWGLERKRWLLAHENAAAGLLREAG

    >gi|33598772|ref|NP_886415.1| stringent starvation protein A [Bordetella parapertussis 12822]
    MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMNPYGQVPILVERDLVLYESNIINEYIDERFPHPQLM
    PADPVMRARTRLFLYNFEKELFVHVCALEDRSAKPDDKKMVQARQSIRDRLAQLAPMLLKNKYMLGDEFSMLDVAVAPLL
    WRLDHYGIELPKNAAPLQKYAERIFSRPAYIEALTPSEKVMRR

    >gi|33598779|ref|NP_886422.1| thioredoxin reductase [Bordetella parapertussis 12822]
    MNPPKHAKVLILGSGPAGYTAAIYAARANLAPLVVTGLAQGGQLMTTTDVDNWPADPDGVQGPDLMQRFLRHAQRFDAGV
    VSDAIHTVRLDRRPFALTGDQGAYTCDALVIATGASAKYLGLSSERAFMGKGVSG
    CATCDGFFYRNRDVLVVGGGNTAVE
    EALYLSNICRTVTVVHRRDRFRAEPILVDRLQARAALGKVKFEYFHELDEVLGDASGVTGARLRDNRDGTARDVAAKGVF
    IAIGHAPDTGLFEGQLALRNGYIVTRGGLSGLATMTSIPGVFAAGDVQDQIYRQAVTSAGTGCMAALDAQRWLEGAA

    >gi|33598781|ref|NP_886424.1| hypothetical protein BPP4295 [Bordetella parapertussis 12822]
    MIAGSITDTACMELSTVSELRDLRATSDEYALFDVRESAQAHQGHIFGATFLPRRMLAARIASLVPRRSTLIVLYDEGGP
    DPRARLAAQTLARFGYTGVRVLDGGLRTWLAQSEAPCRGSNVPNKWFGETVHAHAATPALPIATLQAWRETGSAHRICDI
    RSPEEYGRARIPGAAGAFGSDLAWHADDLRRAGQPVVVH
    CSGRTRSIIACESLRLLGVQDAYALENGTMGWRLAGLALER
    GPGSGSLAASAASRRDGARRTQALARAAGVASVEAAMLARWLDERDAGRTNLYVLDIRQVAEYRAGHLPGAIALPGGLAV
    QRTDEFLPVRAAQVVLVDDDEARAALAGYWLRAMGLPRVAVLAGGLPAWNAAGYALGHGRGRPRPADHADAMAARPCPAH
    DVHEAGARMQRVYVDTQARFLAGRPDAAEWVPFGGLEAWLAARAKRQDERAVVLMAHDESLARSAALNARLAGFDAAVLA
    GGVTAWQAQGLPLASGPGGGVTQAADVVVQPYDAGLQAMRDYLEWEQALTRQAIPTLPLYTAYRVPRPPAADMEQDQEAP


    >gi|33598786|ref|NP_886429.1| putative glutaredoxin [Bordetella parapertussis 12822]
    MNMAHDIVVYATPFCAPCERLKKFLQDKQVPFRSVDLMMDEEAAEKLEDLGIRSSPVLEVDGRYYHGGQLQPDTLAALLG
    LP

    >gi|33598787|ref|NP_886430.1| putative reductase [Bordetella parapertussis 12822]
    MNMAAHCQEPCMGTPVRYIDKTRDYYLSQGYEKPYQWAQYDDVPFTPLGKPLSECRVTLISTSEISIVGDTHPEDETRMG
    IVGGTYTIPSSLPASQLYSPSRSFDQAATTLEDVDAFFPTTHLHAAAQAGRIGGVTERFHGVFNAYSQRRTRERDAPLVL
    ERCKEDGADVAILVPV
    CPVCHQTISLVSRHLEANGIPTVILAAARDIVEHVGVARVVHTDFPLGNPCGEPGNAAQQREIL
    EYGFQLLERAFLPRTTVQSPMRWSAGEAWKDLVFTPQQPWKSGETEQDWLRKKELYKKLKQEGKV

    >gi|33598839|ref|NP_886482.1| thiol:disulfide interchange protein DsbA precursor [Bordetella parapertussis 12822]
    MQSTTFTRLLAAAALAATTLFAPATQAQGAQQYVNINPPMPSDTPGKIEVLEFFAYTCPHCAAIEPMVEDWAKTAPQDVV
    LKQVPIAFNAGMKPLQQLYYTLQALERPDLHPKVFTAIHTERKRLFDKKAMGEWAASQGVDRAKFDSVFDSFSVQTQVQR
    ASQLAEAAHIDGTPAFAVGGRYMTSPVLAGNDYAGALKVVDQLIVQSRK

    >gi|33598873|ref|NP_886516.1| integral-membrane protein [Bordetella parapertussis 12822]
    MQDIHTLLLQYGDWLVFANVLIEQAGLPIPAYPLLIAAGALSGGLGAWLLAWLAATLACVLADSAWYLAGRRYGGRLLGM
    VCKVSLSQDSCIRQTQRLYLRVGVRALLVSKFLPGAGALSTVMAGLTGTPYRRFVAYDLAGSLLWTGSGLLLGALFHELV
    GDVLDLLDRYGGMGLALLGALLALYIVVLGLRRWVLVRSLRVIPRITIDELVRWRADGRTPVVVDVRPEAQRDEQRIPGA
    IAMDLRAPLQDLQFDPEAGDIVVYCA
    CPNEVSAAQLAKKLRAAGYRNTFALRGGYEAWRRHAGNCPGDEQAGS

    >gi|33596112|ref|NP_883755.1| hypothetical protein BPP1457 [Bordetella parapertussis 12822]
    MRAPHRRLAVSTMYSPLSGRAWRGLLLAMLMLLAACSERSADWSLYNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLF
    FGYASCPDV
    CPTTMAQLTAVLQQLGEQARDVRILFVSVDPHRDTPDILQAYVNAFNNNAIGVTGNEKQIADLARRYRLAY
    QIEKPKPGDDADIYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ