Bordetella bronchiseptica RB50 uid57613

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|33599054|ref|NP_886614.1| thiol:disulfide interchange protein [Bordetella bronchiseptica RB50]
    MMQYGHASATGHGASATGRAAAAGRWLAWMLALALVLFARPAAALTEDDFLPPEQAFVFSAAMADPATLVLNYRIAPEYY
    MYRERFGLSASPAQAVTLGEAAYPQGKVKYDPTFDKDMEVFYGTVAVRVPLSQGNGQPFTLTVTSQGCADAGLCYPPMDN
    TVQLMPVAGGYALAAGTASAPQGGGTFDSLLEAGDTRLADFIGGGGWLKTAGVFLLLGMLLAFTPCVLPMVPILSSIVLG
    GAQAQRPSRWRGLGLAAAYVFGMSVVYTALGVAAGLSGAGLAAWLQTPWILSLFAILLAVLALAMFGAFTFQMPAGLQAR
    LSERSNRIPGGRVTGALVMGALSALIVGPCVAAPLAGALLYISQTGDVILGGAALFAMAWGMGIPLLLVGASAGTLLPRT
    GPWMESVKRVFGMLLLGTAWWMLIPVVPTWVQMLGWSFLAVVGAVMLRAFDALPAGSGAPRMFAKGLGLLLALAGAAWLI
    GALSGGRDVLAPLSHLAARAPAGGAVAAAGPAAVDKTRFVRVRSNAELDALLARSTQPVMLDFYADW
    CVSCREMEHFTFS
    DPTVAARMSQMLLVQADVTKNNADDRALLKRFRLFGPPGIMFFEPGGKLIEDIRVVGFQDARRFAGVLEQVADRSGAPGP
    AQAGS

    >gi|33599285|ref|NP_886845.1| glutaredoxin 3 [Bordetella bronchiseptica RB50]
    MPAIPSPPGATMQKVVMYSKDYCPYCARAQALLKQRGVADLEIIRIDQDPSQRDIMIERTGRRTVPQIFIGETHVGGSDD
    LQALDRSGGLLPLLNGG

    >gi|33599286|ref|NP_886846.1| hypothetical protein BB0297 [Bordetella bronchiseptica RB50]
    MLMLPALRKGRAGAAVGTSEAIQMVNQRQAVWVDVRPTEQFQAGHIAQARSLPAADLEKKAGALPKNKPLIVVCEQGRDA
    ARIAARLRSQGFAEVSVLEGGMRAWFAAGLPVTQKG

    >gi|33599290|ref|NP_886850.1| adenylyltransferase [Bordetella bronchiseptica RB50]
    MNDQQLLRYARHILLDELGIEGQERFLAARVLIIGAGGLGCPAALYLTTAGVGHITLVDDDVVELSNLQRQILHASDSVG
    RAKAESGRDMLARFNPETQVEARVERLAGAALDTAVAQADVVLDCSDNFATRHAINRACVRHRKPLVSGAAIRFDGQVSV
    YDLRDAQAPCYHCLFPEADDVEELN
    CATTGVFAPLVGIIGSVQAAEALKLLAGIGQSLAGRLLQLDVRSMQWHSVNVPRD
    PDCAVCGQGGQAAEHARGDAAHCA

    >gi|33599375|ref|NP_886935.1| hypothetical protein BB0386 [Bordetella bronchiseptica RB50]
    MSDVQEFIRETVTQHPVVLFMKGTAQFPQCGFSGRAIQILKGCGVKKLVTVNVLEDDEVRQAIKTFSNWPTIPQLYVGGE
    FIGGSDIMSEMNESGELKQLLDDSGATA

    >gi|33599448|ref|NP_887008.1| carboxymuconolactone decarboxylase [Bordetella bronchiseptica RB50]
    MLDWNQYRSELMTRIGEIAKASPETVKGYQQLSAAGKQTNQLDAKTRELIALAVAVTTRCDGCIAVHAKAATDNGATKGE
    IAEALGVAVALNAGAALVYSARVMDAVDAAQ

    >gi|33599527|ref|NP_887087.1| putative sulfurtransferase [Bordetella bronchiseptica RB50]
    MSEVVSAQWLRQRLESGAECAVVDPREEGAHSVSPHLFHAVNLPLSQLELRVERLFPRRDVPIVVAGAGDALDERARRRL
    QELGYAGAVRLEGGSPAWAGLGLPLFTGFNTASKAFGEYVEHGCATPSISADELREMVASGRPLVIMDSRTPAEHRRATI
    PGSVSAPGAELVLRYAELAPDPHTTLVVN
    CAGRTRSIIGAQSLINAGVPNPVFALRNGTMGWALAGHKVETQSARQAPEP
    GAATLALAQQRAAAVRRRFGIGEIGAAELQRLRAGGERTVYLFDVRTQQEYERGHVPGAVHAPGGQLVQATDSYVAVRNA
    RIVLYDHHGVRDVMTGSWLRQMGHEDVVTLRADAVSAAQLAAGPQAVRVAGLDGARARRLAPAEAAGSLAQYTVVDVGAY
    RDYQAGHLPQAYWVTRARLAEALDGLPADRPLLLVSPDALLAQLACADVAASAARPVYVLEGGMARWRAEGRPVEEGDGR
    PLHEPDDAFVKPFEARDRESSMQAYLDWEVGLLDAVQRHPAIRFDLYKE

    >gi|33600197|ref|NP_887757.1| hypothetical protein BB1211 [Bordetella bronchiseptica RB50]
    MTMRIDYNQVAPGAAAALAGVYGYVMKSGLAPALVELVYLRVSQINNCAYCLDMHTRDLLKQGVAVEKLALLQAWREAGG
    LFDARERAALAWAESVTQVAQTGVPDQDYQDARAVFGEKELVDLTVAIGLMNAYNRMAIGFRNTPKAAV

    >gi|33600220|ref|NP_887780.1| O6-methylguanine-DNA methyltransferase [Bordetella bronchiseptica RB50]
    MNLPVRPAPAYATPEARWAAVQARDPAADSHFVYAVRTTGVYGRPSSAARLPRRENVEFFDNAEAARAAGYRPSRHNAAD
    RTVTARQHSALVAAACRHIEQADTPPTLEALAAHVGLSPFHLHRLFKAETGLTPKAYASAQRARRLRAELGESASVTAAI
    YDAGFNSNSRFYEASQQLLGMAPRAYRAGGANARIRFAVAQCALGAILVAQSQLGICAILLDDDPDYLVRQLQDLFPRAT
    LIGGDAGFERLVAEVVGFVEAPALGLNLPLDVRGTAFQERVWQALREVPPGATASYTDIAERIGAPKAVRAVAQACAANR
    IAVAIP
    CHRVVRRDGDLSGYRWGVDRKRELLRREAATP

    >gi|33600320|ref|NP_887880.1| AhpC/TSA-family protein [Bordetella bronchiseptica RB50]
    MTIKVGDRVPDGTLTEFIETETAGCTLGPNAFQVADLVKGKKIALFAVPGAFTPTCSAKHLPGYVEQAAALRAKGIDEIW
    CVAVNDAFVMGAWGREQQAGGKVRMLADGSALWTTALGLELDLVQRGMGVRSQRYSALIDDGVVKQLNIEAPGKFEVSDA
    ATMLAQA

    >gi|33600526|ref|NP_888086.1| putative transferase [Bordetella bronchiseptica RB50]
    MPSIHPIPPTVADMHFINAQTLKSWLHDGAEIALFDVREHGQYGESHLFHGITLPYSRLEADVQRLAPRRQVRLVVYDDG
    QGIAQAAARRLAALGYGDVHVLEGGTPAWQAAGYALFAGVNVPSKTFGELVEQVYDTPHVTAAELDAMLGAGEDVVVLDG
    RPYAEYRKMAIPGATNCPNGELAYRVGKLVPSDKTRIVIN
    CAGRTRSIIGAQTLINLGLPNPVAALQSGTQGWMLADLEL
    EHGASRRYGGPSDDIEAARGAAEALARRYEVPMVDAETVRGWARDGQRTVFLCDVRTPEEYAAGTLAGAQHTPGGQLIQA
    TDQYVGVRRARLVLFDADGVRARVVASWLCQMGHEAYVLEGGLASGLALPAPAPALPRPDEIDAATLAAWLDEGRPLALV
    DVGASMRYRQAHIAQSRWSIRPLLAAALAGCAEPVVLVADEPGVAACAAAELAGLGVPARVLAGGLQAWIDAGLPVQSSP
    DIPPDEACVDYLFFVHDRHSGNKAAARQYLEWEVNLISQLDERELGEFRLPRR

    >gi|33600881|ref|NP_888441.1| putative sulfurtransferase [Bordetella bronchiseptica RB50]
    MTMTLISAADLAARLDAGGVRVFDVRHDLADHAAGRRAYEQGHIAGARYLDHEAELAAPRSGSNGRHPLPERDAFAGLMA
    AHGVTPETLVVAYDASGGMFAAHLWWMLRWMGHERVAVLDGGWQAWTAAGLPTEAGATPAVSAQPGARAGQSLAGTVDAA
    AVLANIGQPAFTVIDARAANRYRGEVEPMDPVAGHIPGALNRPNTENLQADGRFKAPAQLRQEFEALLGGRAADGIVHQ
    C
    GSGITACHNLLAMEIAGLAGSRLYPGSWSEWCSDAARPVAKGA

    >gi|33600908|ref|NP_888468.1| hypothetical protein BB1923 [Bordetella bronchiseptica RB50]
    MTPLIGKPAPLFTAESTIGPVSLDQCQGRAVVLYFYPKDNTPGCTTESQDFRDLYEDFLAASTIVLGVSRDSLKSHENFK
    TKYELPFPLISDADETVCNLYGVIKQKNMYGKQVRGIERSTFLIDAYGVLVQEWRGVKVPGHAKEVLQAAKSIG

    >gi|33600956|ref|NP_888516.1| hypothetical protein BB1971 [Bordetella bronchiseptica RB50]
    MPPVLYCNDPGRASALSLFLHPLRDVIMSINTSTLDLPSALPPIRINHKPLWAALLLVLAGAAYLLQSVGWRQSALWVVG
    ALLGVTLYHASFGFTQAWRVFVSDRRGAGLRAQMVMLAVGVLLFFPFLAQGTLWGQPVSGFVSPPGVSVVLGAFLFGIGM
    QLGGG
    CASGTLFAVGGGNTRMLVTLLFFIVGSVIATANFGWWSALPALPPTSLIKSWGLPGALLANLAVFALIAWTTTVL
    EKRRHGQLISHAARTSRTPSLLQGPWPMVWGGIALVVLNFATLALAGRPWGITSAFALWGAKALDALGADVASWAYWSRQ
    QAALAAPVRQDITSVMDIGLMLGALAAASAAGKFAPVWKVPARSLLAAVVGGLLLGYGARLAFG
    CNIGAYFSGILSGSLH
    AWLWLPAAFLGSALGVRLRPWFGLAVEKTPAASSC

    >gi|33601090|ref|NP_888650.1| hypothetical protein BB2107 [Bordetella bronchiseptica RB50]
    MKWLRLQDLPTDNSFAALPAEFYTRLQPRPPAAPRLLHANAEAAALIGLDPAEFSTQAFLDVFSGHAPLPGGDTLAAVYS
    GHQFGVWAGQLGDGRAHLLGEVRGPAGGWELQLKGAGMTPYSRMGDGRAVLRSSVREYLASEAMHGLGIPTTRSLALVVS
    DDPVMRETVETAAVVTRMAPSFVRFGSFEHWSARRQPEQLRVLADYVIDRFYPECRVAGAGRLDGEHGEILGLLAAVTRR
    TALLMADWQAVGFCHGVMNTDNMSILGLTLDYGPYGFMDTFQLGHICNHSDSEGRYAWNRQPSVGLWNLYRLASSLHTLA
    PDPEALRAVLDGYEAVFTQAFHGRMAGKLGLPQFLPEDETLLDDLLQLMHQQGADFTLAFRRLGEAVRGQRQPFEDLFID
    RAAAGAWYDRLAARHASDGRAAQARAAAMDEVNPLYVLRNHLAEQAIRAAARGDAGEIDILLKLLRNPYKQQPGYDAYAG
    LAPDWAAGLEVS
    CSS

    >gi|33601140|ref|NP_888700.1| osmotically inducible protein C [Bordetella bronchiseptica RB50]
    MKKTASAVWKGDLKSGQGTISSQSGALKNQPYGFNTRFADQPGTNPEELLGAAHAGCFSMALSNILGEAGLKADSIETTA
    EVTLDKTDDGFTITAVHLTVNAVVPGATKDSFADAAAKAKAG
    CPVSKVLNARISMDATLKG

    >gi|33601261|ref|NP_888821.1| [Fe-S] cluster formation/repair protein [Bordetella bronchiseptica RB50]
    MAVTLTQSAANHVGRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAADDVVFDSFGVKVFIDPKSLAYLDGTELDYA
    REGLNEGFRFSNPNEKATCGCGESFTV

    >gi|33601302|ref|NP_888862.1| putative thiol:disulfide interchange protein [Bordetella bronchiseptica RB50]
    MSAMVQLGPLMLPTALLLMLACVAAGSLAARWRAGSAGAGEMPLMRVLLAGLLAARLAFVWRHREAYLQSPWDVLDIRDG
    GWLAWAGFAGAWACGLWFARRRGPRRRPLLAGLAAATLAWTVGAAVLGIGAPAAIKAMPPLQLATPDGAPRSLAAFAGQP
    VVLNLWASW
    CPPCRREMPMLQRMQAARPDVHFVFVNQGESAQQVNAYLRELGMPLRNVLLDPGAQAGAYFGHRALPATLF
    FDAQGRLVDTRLGELSQASLVQRLGALRPAP

    >gi|33601303|ref|NP_888863.1| disulfide isomerase/thiol-disulfide oxidase [Bordetella bronchiseptica RB50]
    MSDPILPRAAAGLRRACAVLAGAVLAAGAAQAQQPPAPVAALAQHGIEILGTFPAPGGLTAWAAHAGDRPVALYATPDGK
    HVIVGTMFDAEGRDVTQAALEQAIEPALSDKLWSALEQSAWVADGKAGAARIVYVFTDPN
    CPYCNKLWADARPWVEAGKV
    QLRHIPVGILTASSEGKAAAILAAPDPAKALHDHEAGHVASNTRALAAGERKPLDERGIQPLADIPAEIAARLNANETLM
    AQWGLRATPAIVWREQGGRVRKRTGAPPALLPQLFGAL

    >gi|33601404|ref|NP_888964.1| glutathione reductase [Bordetella bronchiseptica RB50]
    MAFDFDLYVIGAGSGGVRAARFAAGYGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHFHEDFEQAAGFGWNPGRPEFDW
    PTLIANKNREIERLNGIYRNLLVNSGVALHEGHARIVDPHTVEINGQRHSAQHILVATGGWPFVPDIPGKEHAITSNDAF
    FLPELPRRVLVVGGGYIAVEFASIFNGLGAQTVQVYRRELFLRGFDGSVREHLRDELVKKGLDLRFNTDVERIDKRADGV
    LAVTLSDGSVLETDCVFYATGRRAMLDDLGLENTGVRLAESGYIEVDDEYRTSEPSILAIGDVIGRVPLTPVALAEGMAV
    ARRLFRPQEYRKVDYDLIPTAVFSLPNIGTVGLTTEQALERGFRVTRYESRFRPMKLTLTQSQEKTLMKLVVDADSQKVL
    GCHMVGPDAGEIVQGLAVALKAGATKQVFDDTIGIHPTAAEEFVTMRTAT

    >gi|33601411|ref|NP_888971.1| putative thioredoxin [Bordetella bronchiseptica RB50]
    MDQIELTDGTADRYLLDAPGLSLLVFHSRTCATCGVARQRLPEFDLPVDRLCWIDAGENGGLVQRYEVFHLPALFVTRDG
    AYYGPVSAQLADWDLRQQISLALDSYPAELP

    >gi|33601454|ref|NP_889014.1| hypothetical protein BB2474 [Bordetella bronchiseptica RB50]
    MSRVPLIDPSQAGAERQAILAQIQGAFGATPNMFKAVANSAAALKSMWEAFGALGGGVIAARLGEQIAVAVANRNRCEYC
    LAAHTALGRKAGASAGDMAAAQDGRSADPRTAAALRFALQLVEARGQVGEAEVQAVRAAGFSDEEIVEILAHVALNLFTN
    YVNVAFAVPVDFPKVALRQAA

    >gi|33601455|ref|NP_889015.1| hypothetical protein BB2475 [Bordetella bronchiseptica RB50]
    MSRHEALATVTAPPLQVDAWLNTPHPLELARLRGQVVVLHAFQMLCPGCLAHGLPQAERLHRLFRDDGVVVIGLHTVFEH
    HAVMGPEALRVFNHEYRWSFPIGIDRPDPEGDMPMTMRAYSLGGTPSLVLLDRRGRIRLHHLGRLDDLALGAAIGRLLAE
    DAESAGAPPA

    >gi|33601479|ref|NP_889039.1| hypothetical protein BB2500 [Bordetella bronchiseptica RB50]
    MITPPDHPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVALVPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQR
    VRDHLDPGRPLGHIDGRPKP

    >gi|33601483|ref|NP_889043.1| putative membrane transport ATPase [Bordetella bronchiseptica RB50]
    MPSTTRDLALDTPSGQRTDAHGHDHAGHDHAGHDHAGHDHAHDHGIPACCGHGHGQPAAPAAAPAWQPGPGQQVTRVRIG
    QMD
    CPTEETLIRKKLASLPEVHELDFNLMQRVLTVLHADGALDRIDAAIRSLGMTPEPLAGDAPATPAGAAAPSRGWRLL
    AAGGVLAALSELAHFTGQPVYVAAALALAAILACGLSTYRKGWIAVRNGNLNINALMSIAVTGAMLIGQWPEAAMVMFLF
    NVAELIEARALDRARHAVRGLLDLAPQTATARQPDGSWAEVPAARLRPGDLVRVRPGERIAADGTISEGQSAIDQSPITG
    ESLPVEKGPDDDVYAGTVNASGSFDYRVTAAAGNTTLDRIIHAVEQAQGARAPTQRFIDRFSRIYTPAVVGLAVLVALAP
    PLLLGHAWLDSVYRALALLIIACPCALVISTPVSVVSGLTAAARRGILIKGGVYLEEGRKLRWLALDKTGTLTQGKPVQT
    DLELLHDASAGGRPALRAAVSLAARSDHPVSRALAQADHALDAPLDEVNGFAALPGRGVQGEIGGERFQLGNRRLMRELD
    VSTPDIEARIDAYEAAGKTAIALADGQRVLLLAAVADTLKASSAAAVADLHRLGVRTLMLTGDNTRAAQAVAAQAGIDEA
    RGDLLPQDKLDAVEAKLDPALRVGMVGDGINDAPALARADIGFAMGAAGTGTAIETADVALMDDDLRKIGTFVRLSRATH
    RILTQNIVLALGIKAVFLVLAMAGQATLWMAVFADVGASLLVVANGLRLLRAGRHQAS

    >gi|33601517|ref|NP_889077.1| dihydrolipoamide dehydrogenase [Bordetella bronchiseptica RB50]
    MSNIVEIKVPDIGDFKEVEVIEVLVAAGDTIKAEQSLITVESDKASMEIPASSAGVVKSVKVKVGDKVAEGTVILDVEAA
    GEAAAAPKAEAPKTEAPKAEAPKAPAAKASAPAAAAYSGSADLECDMLVLGAGPGGYSAAFRAADLGMDTVMVERYATLG
    GV
    CLNVGCIPSKALLHNAAVIDEARALAAHGISFGEPKVDLDKLRGYKDSVVAKLTGGLAGMARARKVRVVTGTGEFADP
    HHLTVTDGEGKKQTIRFKQAIIAAGSQSVKLPFLPDDERIVDSTGALQLRAIPKKMLIIGGGIIGLEMGTVYSTLGARLD
    VVEMLDGLMQGADRDLVKVWQKMNAPRFDNIMLKTKTVGAEARKDGIYVSFEGEGAPKEPQRYDLVLQAVGRSPNGKKIG
    AERAGVAVTERGFIEVDRQMRTNVPHIYAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKSFFDARVIPSVAYTDPEVAWVG
    LTEDEAKKQGVKVEKGLFPWAASGRAIANGRDEGFTKLLFDAETHRIVGGGIVGTHAGDLISEIALAIEMGADMVDIGKT
    IHPHPTLGESVGMAAEVAEGVCTDLPPMRKK

    >gi|33601758|ref|NP_889318.1| arsenate reductase [Bordetella bronchiseptica RB50]
    MHQQRCVMTSITIYHNPACATSRNVLGLIRNSGEEPAIIEYLKTPPDAATLRSLIVAMGMPVRDLLRQKGTPYDELGLSD
    PKWTDEQLIDFMLQYPILINRPIVTTPLGTRLCRPSETVLDLLSRPQRGAFDKEDGQPVIDADGNRV

    >gi|33601785|ref|NP_889345.1| cytochrome C-type biogenesis protein [Bordetella bronchiseptica RB50]
    MLRYLLPLAAFLAMAAFLALGLGRDPRALPSAMLDKPAPPIGLPLLQGDGRRLEVAQLRGRVWVLNVWASWCAPCREELP
    LLQEVGPRDAVPIYGLNYKDKPEDARAWLARHGNPYVASASDVDGRVGIEYGVYGVPETFVIDGAGRIRYRQLGVLTPQI
    WRERLLPVIEGLR

    >gi|33601857|ref|NP_889417.1| putative bacterioferritin comigratory protein [Bordetella bronchiseptica RB50]
    MSRPALLLAALLSIAAPAAHAALPVGAPAPDFSAQASQGGNTFTFELAQALRQGPVVLYFYPAAFTQGCTIEARNFAEAI
    DQYRALGATVIGVSGDDIETLRKFSVSECRGKFPVAADADGAIMKAYDAVHDRRPEYAQRISYVISPQGRIVYEFTDMSP
    DRHVANTLQALRDWQARKK

    >gi|33601858|ref|NP_889418.1| putative arsenate reductase [Bordetella bronchiseptica RB50]
    MSATIYHNPRCSTSRNVLQMLRDAGIEPTIIEYLKTPPSRQTLAGLIQQSGLSVREAVRAKEPIYQELGLDGVDDEGLLD
    AMVDNPILINRPFVVTERGARLCRPAESVREILP

    >gi|33601863|ref|NP_889423.1| glutathione peroxidase [Bordetella bronchiseptica RB50]
    MNTMYDFSAPTITGAERALADFRGQVALVVNVASRCGFTPQYSGLEELYRSYRNEGFVVLGFPCNQFGRQEPDDEAAIAQ
    FCETQYAISFPLFAKIDVNGAHAHPLYRWLKARKPGLLGTRAIKWNFTKFLVGRDGLPLRRYAPAHTPESLRHDIARACA
    APGPTP

    >gi|33601879|ref|NP_889439.1| glutathione S-transferase [Bordetella bronchiseptica RB50]
    MKLYYMAGACSLAAHIVLEWIGKPYETHALSREALKEPAFLKINPLGAVPALTEGDWALTQNAAILEYLAEQAPQLNLLG
    DGTARSRAEVRRWLGFINSDVHKTFSAVFGPQRFVADAAAQEEVRASAAAMLRGLFGQLDTHLQGRSFLAGARPSIADAY
    LYVVLRWAHGKQIDLSGQDNLAAFFERMQADPAVQAALKAEGLS

    >gi|33601986|ref|NP_889546.1| dihydrolipoamide dehydrogenase [Bordetella bronchiseptica RB50]
    MKTLHTDVAIIGAGTAGLAAYRAARAAGKRALLIEGGQYGTTCARVGCMPSKLLIAAAEAAHAAAHGGPFGVHIDGAVRI
    DGAQVMARVKSERDRFVGFVLEGVENIPAEDKLRGMARFVEDTVLRVDGHTEVRAGSVVIASGSRPAVPPPFLALGDRLV
    VNDDVFAWDTLPARVAVFGPGVIGLELGQALARLGVQVRVFGVSGSLGGITDPRVRQSARKAFQQEFYLDPDARVLETKR
    VGDEVEVRYVALDNTERTERFDYALVATGRRPNVDGLDLHNTSLALDARGVPHFDRHTMQAGQAPVFIAGDANADAPLLH
    EAADEGRIAGENAARYPDVAPGLRRAALGVVFSDPQIALVGTPFARLESGTFVAGEVDFGDQGRSRVMLRNRGMLRVYAD
    IESGRFVGAEMVGPSAEHIGHLLAWAAQQSLTVAQMLEMPFYHPVVEEGLRTALRDAAARLAQARPQRLAA

    >gi|33601987|ref|NP_889547.1| putative glutaredoxin [Bordetella bronchiseptica RB50]
    MLQNREGQRVPSVTFPVRENNAWKQVTTDDVFKNKTVVVFSLPGAFTPTCSSTHLPRYNELAPAFFAAGVDSIVCVSVND
    TFVMNEWAKDQESANVTLLPDGNGEFTDGMGMLVDKKDLGFGKRSWRYAMLVKDGVVEKMFIEPEKEGDPFEVSDADTML
    AYVAPQARKPDQVVVFSKPG
    CPFCVDAKALLKGKGFDPIEIPLDNKVRGRVIGAVSGGDTAPQVFINGKLIGGFDALKAY
    LA

    >gi|33602001|ref|NP_889561.1| thioredoxin 2 [Bordetella bronchiseptica RB50]
    MSIVELTKDTFQDAITPDGTLIIDFWAPWCGPCRGFAPVFEQAAEQHPDVTFAKVNTDVEQELAGALGIRSIPTLMVFRE
    KVLLFSQPGALSAGQLGELLTKVKEVDMAEVHRDIAQARENGAGEQA

    >gi|33602206|ref|NP_889766.1| thioredoxin 1 [Bordetella bronchiseptica RB50]
    MTVVCFNPSYTSNKNSGRMLHARAAQRNPRITIMSEQIKNVSDASFEADVLKSGQPVLVDYWAAWCGPCKMIAPILEEVA
    SEYAGRLTVAKLNVDENQDTAAKYGVRGIPTLMLFKDGQAAATKVGALSKSQLTAFLDGAL

    >gi|33602386|ref|NP_889946.1| hypothetical protein BB3413 [Bordetella bronchiseptica RB50]
    MKQVTLYGLNKCSTCVKARDWLAARGVAHDFVDYRDHPVPAATLKQWAGKVGGWEKLVNRTSMTWRALSDERKAARSDAE
    WTALIAEYPALVRRPVTVTPDGEVTVGFSEKRYGERFA

    >gi|33602427|ref|NP_889987.1| antioxidant protein [Bordetella bronchiseptica RB50]
    MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTK
    WIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQL
    TDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK

    >gi|33602642|ref|NP_890202.1| dihydrolipoamide dehydrogenase [Bordetella bronchiseptica RB50]
    MSKQFDVVVIGAGPGGYIAAIRAAQLGMSVACIDAWQNGQGGPAPGGTCTNVGCIPSKALLQSSEHYEQANHHFAEHGIE
    VKGVSLKLDTLIGRKNTVVKQNNDGILYLFKKNKVTYFHGKGAFAGQVDGGWSIKVTGTTDADLVAKHVIVATGSSAREL
    PGLPFDEKNILSNDGALNIGAVPKKLGVIGAGVIGLEMGSVWRRLGAEVTILEAMPEFLAAADQQVAKEALKSFAKQGLD
    IQTGVKIGEIKAAAKSITVPYVDAKGAEQKLVVDKLIVSIGRVPYTGGLNAEAVGLKLDERGFVAVDEDCKTNLPNVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFATVPWVIYTSPEIAWVGKTEQQLKAEGREYKAGSFPFMANGRARALG
    DTTGFAKVIADAKTDEVLGVHIIGPMASELISEAVTIMEFRGAAEDIARICHAHPTLSEAVKEAALAVDKRTLNF

    >gi|33602674|ref|NP_890234.1| hypothetical protein BB3699 [Bordetella bronchiseptica RB50]
    MTQRLDYQQQSPELFKKFVAFSLALKQSSIETSIRDLVDIRASQINGCTFCLDMHVKEATMHGERPLRLHHIAAWRESTL
    FSPRERAALAWTEVLTRIPAEGISDEIHAQVREQLSEQELSDLTFLVMSINAWNRVNVAFRIEPGKYDQAFGVDKSGLS

    >gi|33602775|ref|NP_890335.1| methionine sulfoxide reductase B [Bordetella bronchiseptica RB50]
    MEKIRKTDAEWRTQLTPEEYAVARQKGTERAFSGRYWDTSTPGIYRCIGCGTPLFASDTKFDAGCGWPSYFEPLAPERVR
    EELDTSHGMVRTEVLCNICDAHLGHVFPDGPEPTGLRY
    CINSLSLKFEPLEDE

    >gi|33602787|ref|NP_890347.1| alkyl hydroperoxide reductase [Bordetella bronchiseptica RB50]
    MKTVGDKLEPFKVTGVKPGFNQHEENGVSAFEDITESSFPGKWKVIYFYPKDFTFVCPTEIVGFNKLAKDFEDRDAVLLG
    GSTDNEFVKLAWRREHPDLNKLGHYQFGDTTGALIDQLGVREKGAGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLR
    LLDGLQTDELCPCNRSVGGATL

    >gi|33602788|ref|NP_890348.1| putative antioxidant protein [Bordetella bronchiseptica RB50]
    MEFLSTIKDQLPDWAKDIRLNLDAVIARSTLAPEDALGAALSAAFAARSQLLIDAFKGALSETDANAALTASALMGMNNT
    WYPYVEMTGDAQLKSLPAQLRMNAYATHGGVDKKRFELFALAASIIGKCHF
    CVQSHYENLKKDGLTVEQLRDAGRIASVV
    NAAALALAAQGK

    >gi|33602837|ref|NP_890397.1| hypothetical protein BB3862 [Bordetella bronchiseptica RB50]
    MTTMQQRYDAVKDAMAQIGRLAAQLDGEALREAIGPVLVALGERDELFPRDEFPIRAGKPGGLYQLWRGESGDLALYASA
    GKTGKKQPPHDHTTWAVIAGVYGEEHNVFFERTDDGSRAGFGTLRQIDALTVVQGNAARLSGEVFHTIEVVSEEDSLHLH
    LYGRALDTLSGRINFATEEGGAYTRFMAVPETYAPWIAPRDLYEMLTDGGELAILDVRENGVYTQGHLFHAASMPLSVFE
    LRVDDGLPSPHVRIVVIDDADGLAEQAVRLLHQRGYHNVAVLQGGQPGWNAAGLPVYTGVFVPSKAFGEVAEHVYGTPSI
    SAVELDALRRSEEVLVLDSRTEQEFNLMSVPGAYSCPGAELVARALDHAGPIVVN
    CAGRTRSIIGAQSLRNAGKTDVRAL
    ENGTMGQHLAGLPLERGKSASYLDRPVAAGAAQAAQAWALGMSIATLDASELHDMLSNPYRTTYLFDARDPSCSSRATLP
    RAVAAPGGQLVQQTDYYAPVRNARIVVFDTDGVQAPMTAGWLHQMGWEVYLHRPEATALVAPPRVEYDDERGVPVEAVAA
    DAVIIDVGDSRTYRAGHLAGAAWAPRSRLPALLAQRKPAGPLLFTCADGRVSRLAAADAAAQGYQAAYLKGGTAALGADR
    LRGDAPQFLTEAIDVWYRPYDRETGIEEAMHQYLSWETGLLDKVRSDPTVAFRI

    >gi|33602886|ref|NP_890446.1| thioredoxin reductase [Bordetella bronchiseptica RB50]
    MSTPKHAKVLILGSGPAGYTAAVYAARANLSPALITGLAQGGQLMTTTEVDNWPADVQGVQGPDLMQRFLQHAERFNTEI
    LFDHIAKVDLSRRPFTLTGDTGNLYTCDALIIATGASAKYLGLASEQAFMGRGVSG
    CATCDGFFYRNKDVVVIGGGNTAV
    EEALYLSNICRKVTLIHRRDKFRAEPILVDKLMDKVANGNMELKLFHTLDEVLGDDSGVTGVRIRSTETDATEDLDVAGC
    FVAIGHQPNTGIFEGQLEMKDGYIITKSGLSGMATMTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRWLENAGQ

    >gi|33602909|ref|NP_890469.1| putative thioredoxin [Bordetella bronchiseptica RB50]
    MAAAPFDPAEVFQVFGMRRVDSASFDEQVVRAPGDDLRCVFLWGQDCYNCGIFKQTALLQRQALLALELSWFEADVYADE
    ALGRRFSLHGVPTFVLYRSGKRLGRVTGWPGLPQFSAAMQRLRDGT

    >gi|33602956|ref|NP_890516.1| hypothetical protein BB3982 [Bordetella bronchiseptica RB50]
    MPLHVPGSDIPTLRAALARSDAWLVACFCAAWCDTCQQYRPKLLELARARPGHTFAWIDIEDHPDLLGEEDVENFPTLLV
    QAHGKVLFYGPMLPHIGHLERLLDSLDPQGRPVATGLPDVARLLAAA

    >gi|33603189|ref|NP_890749.1| methionine sulfoxide reductase A [Bordetella bronchiseptica RB50]
    MSSSQPAGPATEAAVLGGGCFWCVEAVFKDLRGVTGIEPGYAGGHVEHPTYEQVCGKDTGHIEVARVEFDPAVLSYGDLL
    RVFFATHDPTTPGRQGNDVGPQYESAIFWQDERQREQAQAVMDELRAQQVFDAPIVTRLLAPAKFWPAEDYHRDYYALHP
    EQGYCQFVIAPKVAKFRKQFQDRLAR

    >gi|33603258|ref|NP_890818.1| hypothetical protein BB4283 [Bordetella bronchiseptica RB50]
    MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEER
    KGIYRLTAKLKLHGDLDDAQIDELLKVADK
    CPLHKLMTATDIQVSTIVVE

    >gi|33603327|ref|NP_890887.1| iron-sulfur cluster insertion protein ErpA [Bordetella bronchiseptica RB50]
    MNAVTETVDLQAPPPVPLVFTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFDEVVNDDDTVLDKAGVQLLV
    DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV

    >gi|33603366|ref|NP_890926.1| thioredoxin [Bordetella bronchiseptica RB50]
    MNRRLFLYAGVAAAAAASGGYFLAERRNARPAPSAAAPAEGAGDPLAQLRQLALPDLQGTPRKLADWGGQPLVVNFWATW
    CAPCVKEMPELDALQKKYPQVRFVGIGVDTADNMRKFVEKIPVSYPLLVMGAGAIDTLRSLGNPSGGLPFTLLLSADGSM
    KRKILGQIVYDDLDRSVAGLSA

    >gi|33603487|ref|NP_891047.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella bronchiseptica RB50]
    MNPPSEQATDILYCDTDTPLGPMRLAARGQALCGAWFVDQRDCPAAAGWTPDAAHPALRQAAAELEQWFAGRRRAFEVDM
    QPEGTPFQRQVWQALLELPFGATISYGELARRVGRPKAARAVAGAVGRNPISILIP
    CHRIIGHDTSLTGFGGGLPRKQAL
    LAHEGHRYLSRAARARRVSTTQMELPFGAA

    >gi|33603492|ref|NP_891052.1| putative thioredoxin [Bordetella bronchiseptica RB50]
    MKKIALVLIIAVAAGIGGWFMWRPAQTAPDVAFTTLEGQKITMQDLRGKVVLVKFWATSCVTCVKQMPDNIANYNQYHPQ
    GYETIAVAMNYDPPNYVLNFAQTRKLPFPVALDTSGELAQAFGNVRLTPTAFLIDKQGQIIKRYLGEYDKAEFQATVQKA
    LAG

    >gi|33603592|ref|NP_891152.1| putative thiol:disulphide interchange protein (periplasmic) [Bordetella bronchiseptica RB50]
    MSGPPFSGAGMNFRITVWCAAAAVWSSGALAQDGAGQAAPGTPDKVYSTTGTAPAKPGDKVYSTRSAQAPDPQADAVKER
    FAQRFEGFDVTAVRRTPYGLFEVQIGTDLLYTDEKVTWVMEGPLIDALTRRDVTRERQEKLSSVPFDELPLDLAVKQVKG
    DGSRVMAVFEDPN
    CGYCKQLHRTLEDMDNITVYTFLYPILSPDSTTKVRDIWCASDPAKVWKDWMVRGQRPPTAECDAPV
    EQWLALGRQLMVRGTPAIFFKSGGRVSGALPRDELEARL

    >gi|33603635|ref|NP_891195.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella bronchiseptica RB50]
    MRGTRAPHTVKAPSNQERIMHFFQAQLESPLGALSLVTDDRQQVRALEFADSPQRLRRLLHLHYGTYTLREAPAPAAIAA
    ALAHYFSGQCDALDGIATATGGSALQQRVWQALRRIPAGEVTSYGALARQLGHDDRQAARAIGGANAANPIALIVP
    CHRV
    IGKDGALKGYAWGLERKRWLLAHENAAAGLLREAG

    >gi|33603667|ref|NP_891227.1| dihydrolipoamide dehydrogenase [Bordetella bronchiseptica RB50]
    MASTMETDLLVLGGGPGGYTAAFRAADLGLSVVLVEQRPTLGGVCLNVGCIPSKALLHCAKALDEARAMSELGIEFSEPR
    IRLDKLRAHKEALVAKLCGGLGGLARQRKVQVVTGTGRFDGPHSLAVSDGSRVAFKQAVIAVGSRPVRLPFLPDDPRIMD
    STGALELKEIPRRLLVIGGGVIGMELATVYAALGARVTVVELTDGLLPGCDRDLVKPLAQRVAGRYEAVLLGTRVSAAQA
    RDDGIHVGFEGPQAPGPQVYDQVLVAAGRRPNGAAIDAERAGVRVDEGGFIRVDAQQRTNVGHIYAIGDVVGEPMLAHKA
    AHEGKVAAETAAGMRVANDARVIPAVAYTDPEVAWVGLTETAAQRDGIAYEKAAFPWAASGRALSLGRGEGLTKILVDPA
    THALLGVGMVGPQAGDLIAEAALAIEMGAEPGDIALTIHPHPTLSETLAFAAEAYEGTLTELYLTRKKS

    >gi|33603711|ref|NP_891271.1| selenophosphate synthetase [Bordetella bronchiseptica RB50]
    MNTPVRLTQYSHGAGCGCKISPKVLEIILAGSGAQNLDPRLWVGNASRDDAAVYALDDQRGVVSTTDFFMPIVDDPFDFG
    RIAATNAISDIYAMGGDPLLAIAILGWPVNVLPPEVAREVVRGGRAACDEAGIALAGGHSIDAPEPIFGLAVTGVVDKAR
    LKRNDTATAGCRLYLTKPLGIGILTTAEKKSRLRPEDVNLARDWMCTLNKPGSRFGALAGVKAMTDVTGFGLLGHLVEMA
    DGSGVSARIEYAKVPRLPGVEHYLAEGCVPGGTGRNFDSYGARIAPLPQDRVDLLCDPQTSGGLLVAVEPAGEAEFLAAA
    GELGLRLEPIGELVAQRPYAVEVL

    >gi|33603846|ref|NP_891406.1| stringent starvation protein A [Bordetella bronchiseptica RB50]
    MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMNPYGQVPILVERDLVLYESNIINEYIDERFPHPQLM
    PADPVMRARTRLFLYNFEKELFVHVCALEDRSAKPDDKKMVQARQSIRDRLAQLAPMLLKNKYMLGDEFSMLDVAVAPLL
    WRLDHYGIELPKNAAPLQKYAERIFSRPAYIEALTPSEKVMRR

    >gi|33603853|ref|NP_891413.1| thioredoxin reductase [Bordetella bronchiseptica RB50]
    MQALGARRPARPFRVPIIAGVEHTAGGWFVNPPKHAKVLILGSGPAGYTAAIYAARANLAPLVVTGLAQGGQLMTTTDVD
    NWPADPDGVQGPDLMQRFLRHAQRFDAGVVSDAIHTVRLDRRPFALTGDQGAYTCDALVIATGASAKYLGLPSERAFMGK
    GVSG
    CATCDGFFYRNRDVLVVGGGNTAVEEALYLSNICRTVTVVHRRDRFRAEPILVDRLQARAALGKVKFEYFHELDEV
    LGDASGVTGARLRDNRDGTARDVAAKGVFIAIGHAPDTGLFEGQLALRNGYIVTRGGLSGLATMTSIPGVFAAGDVQDQI
    YRQAVTSAGTGCMAALDAQRWLEGAA

    >gi|33603860|ref|NP_891420.1| putative glutaredoxin [Bordetella bronchiseptica RB50]
    MNMAHDIVVYATPFCAPCERLKKFLQEKQVPFRSVDLMMDEEAAEKLEDLGIRSSPVLEVDGRYYHGGQLQPDTLAALLG
    LP

    >gi|33603861|ref|NP_891421.1| putative reductase [Bordetella bronchiseptica RB50]
    MNMAAHCQEPCMGTPVRYIDKTRDYYLSQGYEKPYQWAQYDDVPFTPLGKPLSECRVTLISTSEISIVGDTHPEDETRMG
    IVGGTYTIPSSLPASQLYSPSRSFDQAATTLEDVDAFFPTTHLHAAAQAGRIGGVTQRFHGVFNAYSQRRTRERDAPLVL
    ERCKEDGADVAILVPV
    CPVCHQTISLVSRHLEANGIPTVILAAARDIVEHVGVARVVHTDFPLGNPCGEPGNAAQQREIL
    EYGFQLLERAFLPRTTVQSPMRWSAGEAWKDLVFTPEQPWKSGETEQDWLRKKELYKKLKQEGKV

    >gi|33603914|ref|NP_891474.1| thiol:disulfide interchange protein DsbA precursor [Bordetella bronchiseptica RB50]
    MQSTTFTRLLAAAALAATTLFAPATQAQGAQQYVNINPPMPSDTPGKIEVLEFFAYTCPHCAAIEPMVEDWAKTAPQDVV
    LKQVPIAFNAGMKPLQQLYYTLQALERPDLHPKVFTAIHTERKRLFDKKAMGEWAASQGVDRAKFDSVFDSFSVQTQVQR
    ASQLAEAAHIDGTPAFAVGGRYMTSPVLAGNDYAGALKVVDQLIVQSRK

    >gi|33603950|ref|NP_891510.1| integral-membrane protein [Bordetella bronchiseptica RB50]
    MISGGARSTRRALRMQDIHTLLLQYGDWLVFANVLIEQAGLPIPAYPLLIAAGALSGGLGAWLLAWLAATLACVLADSAW
    YLAGRRYGGRLLGMVCKVSLSQDSCIRQTQRLYLRVGVRALLVSKFLPGAGALSTVMAGLTGTPYRRFVAYDLAGSLLWT
    GSGLLLGALFHELVGDVLDLLDRYGGMGLALLGALLALYIVVLGLRRWVLVRSLRVIPRITIDELVRWRADGRTPVVVDV
    RPEAQRDEQRIPGAIAMDLRAPLQDLQFDPEAGDIVVYCA
    CPNEVSAAQLAKKLRAAGYRNTFALRGGYEAWRRHAGNCP
    GDEQAGS

    >gi|33601510|ref|NP_889070.1| hypothetical protein BB2531 [Bordetella bronchiseptica RB50]
    MRAPHRRLAVSTMYSPLSGRAWRGLLLAMLMLLAACSERSADWSLYNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLF
    FGYASCPDV
    CPTTMAQLTAVLQQLGEQARDVRILFVSVDPHRDTPDILQAYVNAFNNNAIGVTGNEKQIADLARRYRVAY
    QIEKPKPGDDADIYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ