Bordetella avium 197N

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|187476578|ref|YP_784602.1| thiol:disulfide interchange protein [Bordetella avium 197N]
    MQAMNRIQRTEVLLWGLLFSLCLLLSFGRAAQAASEADFLAPERAFQFSATQPEPDWLDLHFKVAPGYYMYRERFELVGQ
    PGIDTAAAVFPAGEVKYDPTFEKDMEVYHNDVLIRVPLKLTGEPARMRVTSQGCADAGLCYPPMSHLVTLTPQAGAYAIT
    SSLIEPGQEEAALASAVSTAPATPAKGSLSALLDAGDLGLAGAIGSLGIAGTAGVFFLLGLLLAFTPCVLPMIPILSSII
    VGRGEAPSRGRGLRLALAYVLGMSVVYTALGVAAGLSGAGLSAWLQTPWVLTLFAVLLALLALAMFDAYTLQLPASWQAG
    LSARSNRIPGGRYTGAWLMGAISALIVGPCVAAPLAGALLYISQTGDVLLGGSALFSMAWGMGVPLLVVGASSGALLPKA
    GPWMDGVKRLFGMLLLATAWWMLIPILPVWVLMLGWAFLALVAAVMLCAFEPLPAAAGAVRMFAKGLGLLLALGALVWVV
    GVASGGRDAFAPLAHLAARGQAAPAATPHEPFTRIRSIAELDAALAASTRPVMLDFYADW
    CVSCREMERFTFTDPAVAQR
    MAGMLLLQVDVTQNNAEDRALLKRFNLFGPPGIMFFAPGGRLLEQPRVVGFQDAARFSASLDEALAEAR

    >gi|187476755|ref|YP_784779.1| glutaredoxin 3 [Bordetella avium 197N]
    MQKVVMYSKDYCPYCARAEALLRQRGVTEIEKIQIDRDPAQRDVMIERTGRRTVPQIYIGDTHVGGCDDLQALDRSGGLL
    PLLNG

    >gi|187476756|ref|YP_784780.1| sulphurtransferase [Bordetella avium 197N]
    VDFLQFLIDKNNIFIVAVAVVSGLMLLVSGLRKGGAGAALDTGAAIQMVNHQQAVWVDVRPAEQFQAGHIAQARSVPADD
    LEKKAAALPKNKPLIVV
    CEQGRTSPRIAKRLAALGLTDVRTLQGGMRAWYAANLPVTQKG

    >gi|187476760|ref|YP_784784.1| adenylyltransferase [Bordetella avium 197N]
    MNDQQLLRYARHILLDDLGVEGQEAFLATKVLIIGAGGLGCPAALYLATAGIGHITLVDDDVVELSNLQRQILHTTASLG
    RPKAESGRDMLAAFNPEVVVTPRVERLEGEALAEAVAAADIVLDCCDNFATRHAINRACVRHRKPLVSGAAIRYDGQIST
    YDLRRDDTPCYHCLFPEADEAEEIS
    CATTGVLAPLVGIIGAMQAAEALKLACGLGETLAGRLLQLDVRSMQWHSVNVPRD
    PDCPVCRQR

    >gi|187476776|ref|YP_784800.1| bifunctional protein: include phospholipase and oxidoreductase [Bordetella avium 197N]
    MTYQDIDFLLVGGGLASAQAAETLRREGATGSILILSAESILPYHRPELSKRYLLGTTDAPRLLVHPESFYCKQNIDVAL
    NTAAVSLDAGERLLTTASGSHIRYGQLLIATGATSRQLEVPGASLKGVLPLRSRDD
    CDVIRALIANASPKGLHAVVAGGS
    FLGMEVAMTLAKLGLKVTIVERSTQLLKHLASPLLSDVFRDHAQAAGITVVMNDPVIAFQGQDQVSEVLTEQGRRIPCDL
    AILCTGVKPATQFLESSEISLEDGWVQVDDRLESNVPGVFAAGDVASFFDPVFSRRRHIEHWDNAIKQGRLAAMNMLRRR
    QRYDEVSYFFCEIGDLGFDMLGDPTEDIDQTIARGTLQERSFSLFYLKEDIARAVFTLGRSADETRIAESLIRYRTKLSN
    EKEKLGHPGFALHGLPTQNVLILQGGGALGAFECGVVKALEECQIYPDIVAGISIGAVNGAIIASHPHNATAALEAFWSE
    LEVASLQGAAEPMQRAIAVMQILQLGVDNFFRPRWIPSYDSPWEAPWNWTSFYDTAPMRRLLSKYVDFSSLKSSPVRLLV
    GAVNVLTAEFETFDSYVDDLTPDHILASGSLPPGFSWTFVDGKPYWDGGIVSNSPLDLVIDCCGPDGKRVFIVDLFASQK
    ELPKNMVEIMARRDEIVYSERVRNDLRTRELIDAYRGMIENLLLEIEPQRRERIKRLPRYIQLMGNGTQTQITRFIRQGP
    PDEPSSRDYDFSDIAIRANQKQGYEQAKTILAASSSTARRPPDCGAGSLKDGANANQG

    >gi|187476813|ref|YP_784837.1| hypothetical protein BAV0299 [Bordetella avium 197N]
    MSDVQNFIRDTVTQHPVVLFMKGTAQFPQCGFSGRAIQILKACGVKKLVTVNVLEDDEVRQGIKTFSNWPTIPQLYVQGE
    FIGGSDIMNEMNESGELKTLLDQSGATA

    >gi|187476980|ref|YP_785004.1| rhodanese-like protein [Bordetella avium 197N]
    MSIVNIAAYKFVSLPDTVLLREALQERADALGLKGTILLAPEGINLFLAGSGEAIEAFLAGLRADARFADIEVKYSTSAD
    VPFGKMRVRLKREIIRMNHPAIRPEAGRAPSVNAHTLARWLEQGRDDDGREVVMLDTRNAFEVDVGTFRNAIDWRIDRFT
    QFPDAVREHRAELEGKTVVSF
    CTGGIRCEKAAIFMEDIGIAHVYQLEGGILKYFEETGGPGYDGACFVFDERHALDPALK
    PV

    >gi|187477017|ref|YP_785041.1| hypothetical protein BAV0508 [Bordetella avium 197N]
    MECTIDWGGPSGMLFMATTGSGHVTAMDGAVDGGGHNLAPRPMEMLLAGTGGCTAYDVVLILKRGRHDVSGCSVKLEADR
    ADADPKVFTRIHFAFTVTGRNLPRAAVERAVQLSHEKYCSASAMLEKTAALSFSVEIVDTAAA

    >gi|187477094|ref|YP_785118.1| arsenate reductase [Bordetella avium 197N]
    MSPITIYHNPACGTSRNVLGLIRNSGEDPTIIEYLNTPPAAATLKSLIAAMGVSVREVLRKKGTPYDDLRLSDPKWTDQE
    LIDFMIQHPILINRPIVVTPLGTRLCRPSEQVLDILPQGQRGAFNKEDGEPLVDAEGNRV

    >gi|187477137|ref|YP_785161.1| copper-transporting P-type ATPase [Bordetella avium 197N]
    MTCASCVGRVETALAKVPGVASVSVNLATERADIRLAGPVDRQALVQAVEKVGYDVPAGAVELAVEGMTCASCVGRVEKA
    LKAVPGVSEASVNLATERATVRGVVDTQDLIAAIKKAGYEAHPIDTSMQADAEAAGKKNAERAELKRDLILATVLALPVF
    VLEMGSHMVPGVHEWVAATIGIQQSWYLQFVLTLLVLVFPGRRFYTKGFPALVRLGPDMNSLVAVGTAAAFGYSVVATFA
    PGLLPAGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVGLQAKEAHVRRDGRVIDIPISDVALGDIVEVRPGE
    RVPVDGEVIEGRSFVDESMITGEPIPVEKESGHTVVGGTVNQNGALTLRATAVGGQTMLAQIIRLVEQAQGSKLPIQGVV
    DKVTLWFVPTVMLAALLTFVVWLAFGPSPALSFALVNAVAVLIIACPCAMGLATPTSIMVGTGRGAEMGVLFRKGEALQL
    LKDAKVVAVDKTGTLTEGRPVLTDLEIAEGLDRKQVLAKVAAVESRSEHPIARAIVESAEQSGIAPPEMTNFESITGMGV
    RATVDGSRVEVGADRFMRELGLDVAGFAHTAERLGNEGKSPLYAAIDGRLAAIIAVADPIKASTPAAIAALHKLGLKVAM
    ITGDNARTAQAIARQLGIDEVVAEVLPEGKVEAVRRLKASHGHVAYVGDGINDAPALAQADVGLAIGTGTDVAVESADVV
    LMSGNLQGVPNAIALSKATIGNIRQNLFWAFGYNTALIPVAAGVLYPAYGILLSPIIAAGAMALSSVFVLGNALRLRRFQ
    PPLAADTAANEAP

    >gi|187477168|ref|YP_785192.1| ferredoxin reductase [Bordetella avium 197N]
    MSALGTMLIVGAGQAGAWAARTLREQGHAGRIVLCGAEPHRPYERPPLSKGLITGASTAAEAELLSQAEIQERGIEFLPS
    LAVVSIDPAARQVRCADGREIGYDKLLLATGGSPSRPPLAGLDSARLRVLRTLYDALALRQDFAARPRVAIIGGGWIGLE
    TAATARALGCEVAVIEAGPRLCGRSVMAPLSAELQRRHEAAGVAVHLARGVTGLQDRPDGVKVLFGEGPAIEADLVLLAV
    GMQPNDALAREAGLDCARGVRVDAACRTSDPHIYAAGDVALLSHPRAAQGLRLESWQNAQDQGVAAARAMLGQAVDYAPV
    PLLWSEQYEHMIQIVGFPDLAQHTVSRTLANGGQLFLGLDAGGLAVAAVGIDAGRDFRAARKWVEQGAQPPLADYQACEA
    QAVQEGVA

    >gi|187477247|ref|YP_785271.1| hypothetical protein BAV0738 [Bordetella avium 197N]
    VPRLSAPDLSKLDPETVFLYQQLLRDYGPYGNMLSAFLPRPPALKHLFSYLVESKKEGLISPRHLEIALLAASKAHACHY
    CVTLHEPKLASQGISQQAIDRLLEPEVPGLDDQDLAVRDYAVAVTLDAARIGDGLFARLRRYYDEPAVVELTIRIALCSF
    FKRFNEALEVPSEDVVAFELPAA

    >gi|187477333|ref|YP_785357.1| antioxidant [Bordetella avium 197N]
    MTISVGARVPDGTLTEFIETETPGCQLGPNAFQVADLTRGKKIALFAVPGAFTPTCSAKHLPGYVAQAEAFKAKGVDEIW
    CVAVNDAFVMGAWGRDQHATGKVRLLADGSALWTRELGLELDLIARGMGVRSQRYSALIEDGVVTRLNIEAPGKFEVSDA
    ETLLSQI

    >gi|187477562|ref|YP_785586.1| antioxidant protein [Bordetella avium 197N]
    MEFLSSIKEQLPDWAKDIRLNLDSVIARSTLPQEDALGAALAAAYASGNAFLIKAFQGALPETDANAALTAAALMGMNNT
    WYPYVEMTGDAQLKSLPAQLRMNAYATHGGVDKKRFELFALVASIVGKCHF
    CVQSHYENLKKDGLTTEQLRDAGRIASVV
    NAAALALAAQGK

    >gi|187477563|ref|YP_785587.1| alkyl hydroperoxide reductase [Bordetella avium 197N]
    MKTVGDKLESFKVTGVKPGFNHHEENGVSAFEEITESSFPGKWKVIYFYPKDFTFVCPTEIVGFNKLAKDFEDRDAVLLG
    GSSDNEFVKLAWRREHPDLNKLGHYQFGDTTGALIDQLGVREKGAGVALRATFIVDPDNTIQHVSVNNLNVGRNPEEVLR
    LLDGLQTDELCPCNRTVGGDTL

    >gi|187477575|ref|YP_785599.1| peptide methionine sulfoxide reductase [Bordetella avium 197N]
    MEKVRKTDAEWRIQLSPQEFHVTREKGTERAFTGRYWDTFTHGIYRCVGCGTPLFASDTKFDAGCGWPSYFEPIDPERVR
    EERDTSHGMVRTEVLCNICDSHLGHVFPDGPEPTGLRY
    CINSLSLKFEPDA

    >gi|187477703|ref|YP_785727.1| dihydrolipoyl dehydrogenase (E3 component of 2-oxoglutarate dehydrogenase complex) [Bordetella avium 197N]
    MSKQFDVVVIGAGPGGYIAAIRAAQLGLSVACIDAWQNGEGGAAPGGTCTNVGCIPSKALLQSSENYEAVNHHFVEHGIE
    AKDVKLNLNTLIGRKNKVVKQNNDGILFLFKKNKVSFFHGKGAFVGQVEGGWAIKVTGTSEEDLVAKHVIVATGSSAREL
    PGLPFDEKNVLSNDGALNLSAVPKKLGVIGGGVIGLEMGSVWRRLGAEVTVLEAMPEFLAAADQQVAKEALKAFTKQGLN
    IQTGVKIGEIKAGKSITIPYTDAKGGEHKLVVDKLIVSIGRVPYTGGLNAAAVGLNLDERGFIAVDADCKTNLPNVWAVG
    DVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFDTVPWVIYTSPEIAWVGKTEQQLKAEGREYKAGSFPFMANGRARAIGD
    TTGFAKVIADAKTDEVLGVHIIGPMASELIAEAVTIMEFRGAAEDIARICHAHPTLSEAVKEAALAVDKRTLNF

    >gi|187477866|ref|YP_785890.1| antioxidant protein [Bordetella avium 197N]
    MAHLRLGDTAPDFEQKSSIGTLRFYDYLGDKWGVLFSHPADFTPVCTTELGYTAKLADEFAKRGVKVLALSVDGEDSHKQ
    WIDDINDTQSTQVNFPILADEDRKVSELYDMIHPNANATLTVRSVFIIDPAKKVRLIITYPASTGRNFNEILRVIDSLQL
    TDNYSVATPVNWEDGDDVIIVPSLKDETVIKEKFPKGYKALRPYLRITPQPNK

    >gi|187478012|ref|YP_786036.1| iron-sulfur cluster assembly protein [Bordetella avium 197N]
    MAVTLTQQAANHVSRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYVDDPDAEDVVFESFGVKVFVDPKSLAYLEGTELDYA
    REGLNEGFKFSNPNEKATCGCGESFTV

    >gi|187478056|ref|YP_786080.1| hypothetical protein BAV1556 [Bordetella avium 197N]
    MSTPIKAHGFTNESLEWKAWLDTVRVESATPEQIAVLEESHPKAKTSDYYLFLIHQPEILRQRSTAFNAIMYAPGGLSRA
    ERELGATVVSRINGCVY
    CASVHAQRFEQLAKRNDVIAEVFDDPRTAGTTERERAIAAFSVKITENPAGLDAKDIRALKEV
    GLSEGEILDLVHADAIFAWANRLMLNLGEPIFPQS

    >gi|187478118|ref|YP_786142.1| glutathione reductase [Bordetella avium 197N]
    MAYDFDLYVIGAGSGGVRAARFAAGFGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHFADDFEQSSGFGWAPGHPSFDW
    HTLIQNKNREIERLNGIYRNLLVNSGVTLHEGHARLLDPHTVEINGKRHTAERILIATGGWPFVPDIPGKEHAITSNEVF
    FLKQLPRRVLVVGGGYIAVEFASIFNGLGADTTLAYRGALFLRGFDQSVREHLREELSKKNINLRFDTEIAGIDQLADRS
    LAVTLKDGSVLETDCVLYATGRRAMLDKLGLENTRVRLNDQGYIEVNEQYETAEPSILALGDVIGRVPLTPVALAEGMAV
    ARRLFRPEEYRPVDYDLIPTAVFSLPNIGTVGLTTEQAIERGHRVKRFESRFRPMKLTLTDSQERTLMKLVVDADTDRVL
    GCHMVGPDAGEIIQGLAVALKAGATKRVFDDTIGVHPTAAEEFVTMRTPVAD

    >gi|187478121|ref|YP_786145.1| thioredoxin [Bordetella avium 197N]
    MDQIDINDSTADRQLLDAPGLSLVVFHSETCPNCRVARQQLPDFELPVERIFWVDAGRNGGLVERYEVFHLPAMYLTRDG
    AYYGPISAQLAEWDLRQQIAQALDNHPAELP

    >gi|187478128|ref|YP_786152.1| cadmium-transporting ATPase [Bordetella avium 197N]
    MSKHQLSTPGTCCAPGQRPDARGDAHEHEPAHSHDGDGCCASAASQPKQSGSQLNAGSGQTLTRLRIGQMDCPTEETLIR
    KKLGSMAEVQAMEFNLMQRMLTVVHSDGTLERILDAIRSLGMTPETTTSAPPSQKAGWRLLALGGVLAGLSEAAHFAGQH
    PWLTALLSLAAIAACGLSTYRKGWIALRNGNLNINALMSIAVTGAVLIGQWPEAAMVMFLFNVAELIEARALDRARKAVR
    GLMDLAPQTAHRQNSDGSWSDVPATQLRIGDAIRVRPGERIAADGEIYDGSSSIDQAPITGESLPVEKTIGDAVYAGTIN
    TSGAFDYRVTAAAGNSTLDRIIHAVEQAQGARAPTQRFIDRFSRIYTPAVVLLAILVAVVPPLALGHTWMDSIYRALALL
    IIACPCALVISTPVSVVSGLTAAARRGILIKGGVYLENGRKLRWLALDKTGTLTQGKPVQTDLVVLEPIAANGQPSAQVA
    ASLAARSDHPVSRAMAQASASQDFLTVNDFHALAGRGVAGTIDGTTYHLGNRRLMRELGVLTPDIEASIDAYEQLGKTAN
    ALSDGQGILLLAAVADTLKPSSAAAITDLHALGVQTLMLTGDNNRAAQAVAAQAGIDEAHGDLLPEDKLTRVAAKTNQGG
    LVGMVGDGINDAPALARADIGFAMGAAGTGTAIETADVALMDDDLRKIGIFVRLSRATHRVLTQNIVLALGIKIVFLTLA
    VTGNATLWMAVFADVGASLLVVANGLRLLRAAQ

    >gi|187478159|ref|YP_786183.1| dihydrolipoamide dehydrogenase [Bordetella avium 197N]
    MSNLKEIKVPDIGDFKEVEVIEVLVAVGDTIKADQSLITVESDKASMEIPASEGGVVKSLKIKVGDKVAEGSVILEVEAG
    QAVAAAPKAEALKTEAPKTEAPKTEAQAAAPAAASFGGSVDLECDVLVLGAGPGGYSAAFRAADLGLSTVLVERYATLGG
    V
    CLNVGCIPSKALLHNAAVIDEARALAAHGISFGEPKIELDKLRGYKESVVNKLTSGLAGMARARKVTVVTGVGEFADPY
    HLTVKAADGKTQTIRFKNAIIAAGSQSVKLPFLPKDDRIVDSTGALELREIPKKMLIIGGGIIGLEMGTVYSTLGARLDV
    VEMLDGLMQGADRDLVKVWQKMNAGRFDNIMLKTKTVGAEARADGIYVSFEGEGAPTAPQRYDLVLQAVGRSPNGKKIAA
    DKAGVAVTDRGFIEVDSQMRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEVAAGQKSFFDARVIPSVAYTDPEVAWVGL
    TEDEAKKQGIKIEKGVFPWAASGRAIANGRDEGFTKLIFDAETHRILGGGIVGTHAGDLISEIALAVEMGADVVDIAKTI
    HPHPTLGESVGMAAEVAEGVCTDLPPQRKK

    >gi|187478225|ref|YP_786249.1| disulfide bond formation protein B [Bordetella avium 197N]
    MTPPASTARRRLLLLIALFCFGAVGLALISQYAFDMAPCAWCVMQRMIYLAMGLIALFAAVGSPALARVGALLAAVLSAC
    GIAAAWYQYSVAAKMLS
    CDQTFADRFVSGTGLDAAVPSVFGIFATCMDAMVSVLGIEYAIWSLALFVILLILALFALFKR
    H

    >gi|187478323|ref|YP_786347.1| arsenate reductase [Bordetella avium 197N]
    MPHSATIYHNPRCGTSRTALQALQDAGYDVTVIEYLKTPPSRQTLAGLIQQSGLQVRDAIRAKEAIFQELKLDDPQLTDE
    DLLNAMLDNPILINRPFVMTEKGVRLCRPAEVLNDILG

    >gi|187478327|ref|YP_786351.1| glutathione peroxidase [Bordetella avium 197N]
    MTTFYDFSAPSLSAESIPLSQWRGQVVLVVNVASQCGFTPQYSGLEALYQRFGAQGFTVLGFPCNQFGRQEPGDADEIRR
    FCDTRYGITFPLFAKIDVNGGDAHPLFRWLKSQKPGVLGTEVIKWNFTKFLIGRDGQVLARYAPTDAPDSLVADIEKALA
    APAA

    >gi|187478335|ref|YP_786359.1| membrane protein [Bordetella avium 197N]
    MPAALILVALLAGAWRFADLPGPGRDLSLSLLLGTAFGVVLQRSRFCFYCIARDYLQAGETAGLYAILAALAVGTLGYLV
    VFGAFLPLPSAERLPPGAHIGPVSFALVLGAFVFGVGMAVSGS
    CISAHFYRLGEGATASPFALLGAVLGFVLGFLTWNPI
    YLALIQDAPVVWLPRHLGYGGTALLQLALLLLIVVWIARRDRPVPAEVPPATLWEAVAYRRWPPALAGALVGAIGVVAYL
    RLAPLGVTAELGSVARTAADQAGWLPARLHGLDGFAGCATLVKEVLWSNNGVFVLGLVSGAWAAALNAGAFKPRRPQRVT
    ANFVGGVLMGWGGMTALG
    CTVGTLLSGIMAGALSGWIFGLACLAGIAVTLRLKRG

    >gi|187478336|ref|YP_786360.1| thiosulfate sulfurtransferase [Bordetella avium 197N]
    MFLRRWVNTFIAAGILLAAPVAAQPSDFLVSTEWLEKNLSDPKLRVVEVSVNPGLFERGHIPGSANFNWHTDLVDTVSRD
    IASAPKFEALLRNAGINQDTVTVLYGDNNNWFAAWGAWLFDIYGVQNVKLLDGGRKKWEAEGRPLSNRSKVHAPGNVQVK
    AADTTLRAHLSDVLAVARKEKDAVLVDIRSADEYNGKIFAPNGVPELAVRAGHVPGAVNVSWGKLVAEDGTFKPVEELKT
    IYQSVGVDGSKPIITY
    CRIGERSSHSWFALRKLLGYDVRNYDGSWTEYGNSVGAPISNPSGTVWGKT

    >gi|187478464|ref|YP_786488.1| mercuric ion reductase [Bordetella avium 197N]
    MKILHTDIAIIGAGTAGLAAYRAARAAGKQALIIEGGPYGTTCARVGCMPSKLLIAAAEAAHAAQNTSAFGVHIGGPVSV
    DGQAVMARVKRERDRFVGFVVEGVEQLPAQDKLHGYARFLSDTVLRVDDHTEVHACRVVIASGSRPAIPAPFLALGDRLV
    VNDDVFAWDSLPGRVAVFGPGVIGLELGQALARLGVHVRVFGVSGSLAGISDPAVRQAARKVFQSEFYLDPDARVLETRR
    IGDEVEIRYITLDNTECVERFDYALVATGRRPNVDKLGLENTTLELDARGVPHFDRLTMQAGQSAIFIAGDANADAPLLH
    EAADEGRIAGDNAARYPDIRPGLRRAPLAVVFSDPQIALVGTSYARLRPGEFVTGAVDFSDQGRSRVMRKNRGLLHVYAE
    IGSGRFLGAEMIGPSAEHIGHLLAWAAQQELTVARMLEMPFYHPVIEEGLRTALRDAASRLAAA

    >gi|187478465|ref|YP_786489.1| antioxidant [Bordetella avium 197N]
    MLQNREGQRVPNVMFPVREENNWKKVGTDDIFKNKTVVVFSLPGAFTPTCSSTHLPRYNELAPTFFAHGVDAIVCVSVND
    SFVMNEWAKDQESTHITLLPDGNGEFTAGMGMLVDKSDLGFGKRSWRYSMLVEDGVVRKMFIEPEKEGDPFEVSDADTML
    AHIAPAAKKPDQVVVFSKAG
    CPFCIEAKALLDERGYDPIDIPLEHKVRSRVIGAVSGAGTAPQIFINGKLIGGLDHLKAH
    FA

    >gi|187478478|ref|YP_786502.1| thioredoxin 2 [Bordetella avium 197N]
    MSIVELSKDSFQEAIKPHGTLIIDFWAPWCGPCRGFAPVFEQAAEKHPDVTFAKVNTDVEQELAGALGIRSIPTLMVFRE
    KVLLFSQAGALSAGQLEELLTKVKEVDMVQVHRDIAQAREKPEGEQA

    >gi|187478621|ref|YP_786645.1| membrane protein [Bordetella avium 197N]
    MSTATLQLPANPVNRKPLWFASLLVLAGAAYLLETVSWKQSALWIVGALLGVTLYHASFGFTQAWRVFVSDRRGAGLRGQ
    MAMLAFGVVLFFPFLAAGSLFGQPVNGLVSPPGLSVLLGAFLFGIGMQLGGG
    CASGTLFAVGGGNTRMVVTLLFFIVGSV
    FATANFPWWSSLPALPPTSLIKTWGLPTALIVNLAVFSLIAWLTTVFEKRRHGQLISSATHTDRPATLLRGPWPLIWGGL
    ALVVLNFATLALAGRPWGITSAFALWGAKTLDALGSDVASWAYWSKQQAALAAPVSRDVTSVMDIGLMLGALAAASSAGK
    FAPVWKVPLRSLAGAIIGGLLLGYGSRISFG
    CNIGAYFSGILSGSLHAWLWLPAAFLGSALGVQLRPLFGLAVEKNPAPS
    SC

    >gi|187478656|ref|YP_786680.1| antioxidant protein [Bordetella avium 197N]
    MTALIGKPAPQFTAESTIGPIDLEQCQGRAVVLYFYPKDNTPGCTTESQDFRDLHADFLAASTIVIGISRDSLKSHENFK
    TKYQLPFPLISDADETVCNLYGVIKQKTMYGKQVRGIERSTFLIDAYGVLVQEWRGLKVPGHAKEVLQAAKSIG

    >gi|187478672|ref|YP_786696.1| thiosulfate sulfurtransferase [Bordetella avium 197N]
    MTMTLISVADLAARGAAVRIFDLRHDLMDHSAGARAYAQAHIPGARYLNHETELSATRTGKNGRHPLPDRDLFAGLMAAH
    GVTPETLVVAYDASGGIYAAHLWWMLRWIGHDRVAVLDGGWQAWTAAGLPTQSGAGESVAPLAGVHAGAPQVASVDVQAV
    LANIPVQAFTVIDARAANRYRGEVEPMDPVAGHIPGALNRPNVENLTQEGRFKSPEQLRAEFTALLDGRAPESIVHQ
    CGS
    GITASHNLLSMEVAGLSGSRLYPGSWSEWCADPARPVAKG

    >gi|187478708|ref|YP_786732.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella avium 197N]
    MSTCSPPFFQLKLRAPGQPVAGPIRYVCGPIRLGRVLIGLSQEGVCCIFIGDSDAALRLQLESVFSTVPLVPVEHAPELA
    LITDFLDLGRAAGHIELDVGGTSFQQSVWQALCDIPAGQTRSYTEVAQGLKRPEAVRAVAGACAANVLAVLIP
    CHRVLRQ
    DASLTGYRWGIERKRLLLEQERAR

    >gi|187478740|ref|YP_786764.1| arsenate reductase [Bordetella avium 197N]
    MTTLYGLSKCSTCVKAREWLSAHGVKHDFIDYRDHPVPATTLQAWAGKLGGWEKLVNRASMTWRGLSDDQKAASTPAQWT
    RLIAEYPALVRRPVVVTADGEVSVGFSEKRFAERFA

    >gi|187478767|ref|YP_786791.1| hypothetical protein BAV2277 [Bordetella avium 197N]
    MMLSKLDALTLDNSFAALPDTFYTRLAAQPLGRPRLLHANAEAAALIGLDPAELHTQAFLEVASGQRPLPGGDTLAAVYS
    GHQFGVWAGQLGDGRAHLLGEVRGPGGSWELQLKGAGLTPYSRMGDGRAVLRSSVREYLASEAMHGLGIPTTRALALVVS
    DDPVMRETRETAAIVTRMSPSFVRFGSFEHWSSRRDGERLRILADYVIDRFYPQCREANGEHGDVLALLREVSQRTAHLM
    ADWQSVGFCHGVMNTDNMSILGLTLDYGPFGFMDAFQLGHVCNHSDSEGRYAWNRQPSVALWNLYRLGGSLHGLVPDADA
    LRGVLAEYETLFTQAFHARMGAKLGLSVWQSDDEALLDDLLRLMHDSRADFTLTFRALAQAVRGQTQPFLDYFIDREAAQ
    AWWSRLAARHACDGRAAAVRAEGMDRVNPLYVLRNHLAEQAIRAAQQGDASEIDRLLGLLRRPYDLQPGAEAYAALPPDW
    AAGLSVS
    CSS

    >gi|187478869|ref|YP_786893.1| thioredoxin 1 [Bordetella avium 197N]
    MSDIPIMSEQIKNVSDASFEGDVLKSSQPVLVDYWAAWCGPCKMIAPILEEVASEYAGRLTVAKLNVDENQGTAAKYGIR
    GIPTLMLFKDGQAAATKVGALSKSQLTAFLDSAL

    >gi|187478927|ref|YP_786951.1| hypothetical protein BAV2437 [Bordetella avium 197N]
    MAIKYLARRPPQPMMPGFLSRWTKTMSNLNEYLKQKREAVLIRHARDPLTIEPARLKAHVSAEGRSGVRRIRIRDHQVLS
    DSPADYAGYDLGPSSPELLLGCLGS
    CLTHIFLIKAAEAQLPLDALDVDIEGDLDPRGGKPGYETLPFYPHNIRYTAHLVS
    PASEAEVKAVHEAVQAWCPILNLLKQGQPVHATLRHTQSAPH

    >gi|187478935|ref|YP_786959.1| organic hydroperoxide resistance protein [Bordetella avium 197N]
    MSLEKVLYRSHVSVTGGRDGAAVSDDKHLDIKLTTPKELGGAGGAGTNPEQLFAAGYAACFMGAMKFVAARDKIAIPHDV
    SIVGSVGIGPLPTGFGIEAELKISLPGMDRAAAQQLIERAHIV
    CPYSNATQGNIDVTLTLV

    >gi|187479080|ref|YP_787105.1| carboxymuconolactone decarboxylase [Bordetella avium 197N]
    MLDWNNYRSELKARIGELGVLSPGTLSGYQALSAAGSKTKHLDAKTRELIALAVAVTTRCDGCIAVHAAQAAKEGATKEE
    VAEALGVAVAMNAGAAMVYSARVLDALPE

    >gi|187479151|ref|YP_787176.1| detoxifying sulphurtransferase [Bordetella avium 197N]
    MSLPLISAQTAKARIAQGAVLADIRSMDEYAREHIAQARHVPVESLQSKKMASDGAKAVIFYCKSGNRTKMNAAALRAGV
    EGEAYILDGGLDAWKKAGLSVEKNAAQPLELQRQVQITVGLLVLLGTILGAAVSPWFLLLSGFVGTGLFVAGVTGFCGMA
    RLLMRMPWNQQALLK

    >gi|187479169|ref|YP_787194.1| thioredoxin reductase [Bordetella avium 197N]
    MSTHAKVLILGSGPAGYTAAVYAARANLKPLLVTGLAQGGQLMTTTEVDNWPADVDGVQGPALMERFQKHAERFNTEIVF
    DHIAKVDLSQRPFTLTGDTGNVYTCDALIIATGASAKYLGLPSEEKFMGRGVSG
    CATCDGFFYRNQDVVVIGGGNTAVEE
    ALYLSNICRKVTLIHRRDKFRAEPILVDKLMDKVQNGNMELRVFSTLEEVLGDDSGVTGVRIRNVETGATEDLAALGCFV
    AIGHQPNTGIFEGQLDMKDGYIVTKSGLNGLATMTSVPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRWLENAGN

    >gi|187479190|ref|YP_787215.1| thioredoxin [Bordetella avium 197N]
    MSSFDPGQVFEVFGMQPVSSATFDERVVEAPGDDLRCVFLWGENCYNCNIFKQTALLHRDALLALRLSWLQADVYADPAL
    GQRFGLHGVPTFVMFRGGKRLGRITGWPGLPQFSETVRRLQAGS

    >gi|187479201|ref|YP_787226.1| thiol:disulfide interchange protein [Bordetella avium 197N]
    MFSWPSPHSLRHSLIAGLMLLSAGSYAQATEQPAVLKALEGQGLVVMQEFKVGGGLRAFAAVAGDQPVAIYVTSDGNAIL
    GTRLDSKGESLDDETLEKLAAKPISDKTWAQLEAAKWVRDGSANAPRVIYTFSDAN
    CPYCHRFWEAARPWVDAGKVQLRH
    IMVGVIRQDSPGKAAAILEASDPSAALVENELNFDKGGIKPLAKISDSVRRTLEDNRLLMLDMGFRGTPGIVIKDDTGLV
    QKIRGMPQAASFEEVFGPR

    >gi|187479202|ref|YP_787227.1| thiol:disulfide interchange protein [Bordetella avium 197N]
    MTGIGPYSFEVFFFFAAVLIAWVTARLAARKVPGSVHGLLLDAVFWGAVAARLVYVAMWWPDYAASPRSIVSLSDGGFSW
    WAGVCVALALVWWKTRSSRALRAPLLSGLAAGVVVWFAAAGVLQQLRTQAPPLPDVALHALDGQSVSLDAYLGKPVVLNL
    WASW
    CPPCRREMPVLQQAQAEFPQVNFVLINQGESAQHIRDFLGREHLEFKDMLLDPASRMMHAMGARGLPATLFFDAQG
    RLVDTHLGELTMATLKHTLSRRFSFSSPSHTE

    >gi|187479232|ref|YP_787257.1| thioredoxin [Bordetella avium 197N]
    MPLLLPNSQALRDALAQTDRLLVACFCAAWCDTCQQYRIKLEALARARPELVFVWIDIEDHPDLLGDEDVENFPTLLVQA
    PDRIRFYGTMLPHIGHLERLLDSLSTDAPPIQTGLPDVRGLLAGA

    >gi|187479366|ref|YP_787391.1| peptide methionine sulfoxide reductase [Bordetella avium 197N]
    MSETPSCSGTEIAVLGGGCFWCVEAVFKDLRGVVSVLPGYAGGHVDHPTYQQVCNKDTGHIEVARIEFDPAELSYADLLR
    VFFATHDPTTPGRQGNDVGPQYESAIFWQNDKQRQEAQAVIGEIDSAQIYDAPIVTKLLAPATFWPAEDYHRDYFALHPE
    QGYCQFVIAPKVSKFRKQFQSRLKS

    >gi|187479436|ref|YP_787461.1| hypothetical protein BAV2966 [Bordetella avium 197N]
    MNAITETVDLQAPPPVPLVFTDSAAAKVKDLLAEEGNPELKLRVFVQGGGCSGFQYGFTFDEVVNEDDTVLDKEGVQLLV
    DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNATTTCGCGSSFSV

    >gi|187479469|ref|YP_787494.1| thiol:disulfide interchange protein [Bordetella avium 197N]
    MNRRLFFTAGAAVIVVAAGGLLYSRSRPAASPDPLQQLLASSLPDLHGQPQALTQWRGRPMVINFWATWCAPCVKEMPEL
    EALSKKAAKVQFVGIGVDTADNMRKFVEKLPVSYPLLVMGSAAIDTLRKLDNPSGGLPFTLVLNADGSIRQKILGQIDPN
    TLEKTVLDLVV

    >gi|187479590|ref|YP_787615.1| Ada regulatory protein (methylated-dna--protein-cysteine methyltransferase) [Bordetella avium 197N]
    MTTSSPDTAADPRWAAVLARDPQADAQFVYAVKTTGVYNRPSSAARLPRPENVVFFASAQEAEAAGYRPSKAADQTRVAQ
    MHASWVERACRRIEASDSLPILADLAAELGVSAYHFHRIFKAATGLTPRTYAQAHRARRLRQQLDQGGNVTDALYAAGFN
    SNSRFYAAADTMLGMKPSDYRGGGANAVIHFAVGQCSLGAILVAQSERGVCAILLGDEPEPLLRALQDRFSNAELIGGDP
    AYEGLMATVVGMVEAPGTALDLPLDVRGTAFQERVWQALTRIAPGETVSYGEIARRIGMPRAVRAVAQACGANMLAVAIP
    CHRVVRNDGALSGYRWGVARKRELLRREQVQTADSMAS

    >gi|187479618|ref|YP_787643.1| selenide,water dikinase (TCA) [Bordetella avium 197N]
    MSTDTSPRLTSLSHGGGCGCKIAPGVLSELLARFVPQRHDPNLLVGTETSDDAAVYRLNDQQALIATTDFFMPIVDNPFD
    FGRIAATNALSDIYAMGGKPIMALAIVGMPINVLPHDVIADILRGGESVCQDAGIMIAGGHSIDSVEPIYGLAAMGLVHP
    DLIKRNADARAGDVLILGKPLGVGILSAALKKNRLDDAGYAAMLAATTQLNRPGPDLAALPGVHAITDVTGFGLLGHTLE
    MARGAGLTARLRMADLPWLAGVRGLAADGVITGASGRNWASYGSSVRLGPSLSETDRALLTDPQTSGGLLVACAPEAASQ
    VLSIFAAAGFKDAAVIGDMAAGDAVVEVA

    >gi|187479630|ref|YP_787655.1| methylated-DNA--protein-cysteine methyltransferase [Bordetella avium 197N]
    MIRGIEDASALDIDTPLGGVRLMASGLSLCGLWFADQPELPEPGRGASSAAERAVLGRAQEQLRAWFAGERQDFDLPLAP
    RGTAFQQAVWAGLLDLPFGVTISYSELARLIGRPRATRALAQAVGRNPISIIIP
    CHRVIGQDTALTGFGGGLDRKQRLLA
    HEGHRYSGRSARARRVCDGQMDLPW

    >gi|187479635|ref|YP_787660.1| thiol-disulfide oxidoreductase [Bordetella avium 197N]
    MKKVALAFAAIIIAGIGAWFVWRPAPEVPPVVFTMLDGKQVSLQDLKGKVVLVKFWATSCVTCVKQMPDTISAYKEYAPK
    GYEAIAVAMQYDPPNYVRNFVQGRKLPFPVAIDSTGDIARAFGDVRLTPTAFLIDKQGRIIKRYLGEYDRAEFHATVEKA
    LAQG

    >gi|187479699|ref|YP_787724.1| thiol:disulphide interchange protein (periplasmic) [Bordetella avium 197N]
    MKARIIVLLASLLCANAYAQNGYSASTAQSSGQNDTVYSTNQVGKPATNGGKVYSTTQVQPPDPVTDAVRKRFQLRFQDL
    KIGVVRPTPYGLFEVQLGGDMFYTDKDVSWVMKGPLIDAATRRDVTRENLEKLSAVSFSELPLDLAIKQVKGQGKHRIAI
    FEDPN
    CGYCKQLRHTLKEMDDVTIYTFLYPILSPDSTVKARDVLCAADPGKVLDAWMLEGKPPAPAHCRAPIEELVALGE
    KLRVRGTPTLFFEDNTRAAGVLPPAQLRERLTRNVSQ

    >gi|187479802|ref|YP_787827.1| stringent starvation protein (glutathione S-transferase) [Bordetella avium 197N]
    MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVMRARTRLFLFNFEKELFVHVSALEDRSAKPDDKKMVLARQAIRDRLAQLAPLLLKNKYMLGEEFSMLDVAVAPLL
    WRLDHYGIELPKNAAPLQKYAERIFSRPAYIEALTPSEKVMRR

    >gi|187479833|ref|YP_787858.1| thiol:disulfide interchange protein [Bordetella avium 197N]
    MLSSSISRLLAAAALAATTFFAPASHAEGNAYVTLSPALPSDTPGKIEVLEFFAYTCPHCAAIEPMVEDWAKTKPEDVVL
    KQVPIAFNAGMKPLQQLYYTLMALDRPDLHIKVFNAIHGERKRLFDKKAMGDWVASQGVDRAKFDAVFDSFSVQTQVQRA
    NQLAEAYRIDGTPSFGVGGKFLTSPVLAGNSYEGAIKEINKLIPMARAK