Blattabacterium Periplaneta americana BPLAN

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|261749256|ref|YP_003256941.1| thioredoxin [Blattabacterium sp. (Periplaneta americana) str. BPLAN]
    MVRTYSSDEIKIKIKNFELLETVSGKNKFLQDFFSDKATVIMFICNHCPYVKHINTELVRLANDYLHKGVSFLAINSNDI
    EKYPEDSPENMQKISHQLGYPFPYFFDEKQEVAKYYGAKCTPEFFIFNGVGDLCYHGQLDDSRPGNGISVTGFDIRKVLE
    GLLKGIETSITAKPSYGCNIKWKI

    >gi|261749374|ref|YP_003257059.1| alkyl hydroperoxide reductase subunit C [Blattabacterium sp. (Periplaneta americana) str. BPLAN]
    MNTLIAKKAPNFTASAVLNGKDIVKNFTLEKFQGSKYVLLFFYPKDFTFVCPTEIYAFQEKMKDFESRNVQVIAISTDTE
    QSHWAWLQIPKEKGGIYGVTYPLVSDINKTISHNYGVLSGDWIFDKEELKSTGELIAYRGLFLIDKQGIIRHILINDFPL
    GRNVNEAIRMIDALQYYEKSGEVCPANWIKGKRAIKASHRGLLDFYSSSDE

    >gi|261749400|ref|YP_003257085.1| thioredoxin [Blattabacterium sp. (Periplaneta americana) str. BPLAN]
    MIQEINDDNFEKIIFESNKPVLVDFWAPWCAPCRTLSAILEDIFTEYIGKALVVKLNVDNNPKTSSQYGIRSIPTMFFFK
    NGEKKDMHIGVSSKEDIRKKLEALI

    >gi|261749492|ref|YP_003257178.1| dihydrolipoamide dehydrogenase [Blattabacterium sp. (Periplaneta americana) str. BPLAN]
    MYFDVIVLGSGPGGYVASIRAAQLGMKTALIEKESLGGVCLNWGCIPTKSLLNTAKKLQQIRENRDLFGIKNPLEIDFSK
    IISKSRQVVDKMRNGLSFLMKKNGIHVIYGNAKLKNGKKIEIFRNGEKFEECYASHIVIATGSRSRIDKKIPQDGKKIIG
    YKEALSLPFLPKKIIIIGSGSVGLEFSYFYHSMGSKVTIIEQCSQLFPNGDEEISDQLKSSFDKIGIQCYVSSFVKEINC
    TDKGIVADIHTIDRDFLLEADIVISAIGTVSNIEFIGLEEVGIYTKKGFIAVDENYRTNVDGYYAIGDVIEGPSLAHVAS
    HEAIVCIENIKGLNPQKIDYNNIPKCVYCLPEIASVGYTEREAREKGYQIRVGKFPFSALGKSVCDGNTEGFVKVIFDDK
    YDEWLGCHMIGNHVTDIISEVVVARKLEATNHEIITCIHPHPSLSESILESVAHAYGKAIHL

    >gi|261749549|ref|YP_003257235.1| dihydrolipoamide dehydrogenase [Blattabacterium sp. (Periplaneta americana) str. BPLAN]
    MNNLYDLIVIGSGPGGYVSAIRASQLGIHTALIEKYQDLGGTCLNVGCIPSKSLLYSSKYFFFAKNHHHSHGIIYDKLSL
    DLEKMMKRKNEIVKKTNEGVKYLMKKNNIDLYKGLASFKKNHVISITDRKTFKNIQEIQFKYCIIATGSKPIGLPFSNFE
    KRKKIISSTEALSMNEIPKKLIIIGGGIIGLELASIYHRLGSQVTIIETMDRIISNMDHSLSQEIQKILEKSGIQIETSL
    LIQDIVSLDSNEITVYVKNKNNGKKMKYIGDYCLISIGRKPYTENLGLEHIGIQKDQKGFILVNDFLQSSVENIYAIGDV
    IGGKMLAHKAEEEGLYVAEHLAGQKPNKINYNLVPSVLYTNPEVSSIGFTEKEIQNKGIEYNIGFFPMRILGIARASGST
    EGFVKILSHKKTDEILGVHMIGDHASDMIMEASVAMEFRASSEDIYRICHPHPTFSESFKEAALLSFENKAIHM

    >gi|261749647|ref|YP_003257333.1| thioredoxin reductase [Blattabacterium sp. (Periplaneta americana) str. BPLAN]
    MLKKNKIMDCVILGSGPAGYTAAIYAARADLHPILFVGMQPGGQLTSTTKVDNYPGFPVGISGNELMENCKKQAERFNTI
    IIHKTITKVDFSDKKGGIHRVYMVENEENIIESKGIIIATGSSPKFLGMDKEKKFLGLGVSF
    CATCDGFFHKGKDVAVIG
    GGDTALEEASYLSKICRNVYLVVRKNYFRASKALQYRISKINNVNIFFCSQITKIMGNDFLEGIQIFNTKKKISRTILIS
    GLFIAIGHSPNTKLFKNQLNLDERGYIIVEKGSTSTNKPGVFAAGDVQDSTYRQAVTSAGTGCMAALDLEKYLCLC

    >gi|261749668|ref|YP_003257354.1| FeS assembly scaffold SufA [Blattabacterium sp. (Periplaneta americana) str. BPLAN]
    MVFISDQAKSKLNSIMKEEGISNEISFIRFGVKKGGCSSFSYELTFDQKQKKEDKLFQYGDMKILVDKNSFPYLAGTTLE
    YSGGLNGKGFYFKNPNAKHTCGCGKSFSS