Blattabacterium Blattella germanica Bge

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|262340813|ref|YP_003283668.1| scaffold protein for iron-sulfur cluster assembly [Blattabacterium sp. (Blattella germanica) str. Bge]
    MVFISEKAKNKLISLMKEEGLSHNVSFVRFGVKNGGCSGMSYELTFDQEKQKGDRFFQHQEMKILVDQNSIPYLEGTTLE
    YSDGLNGKGFYFKNPNAKHTCGCGKSFSS

    >gi|262340834|ref|YP_003283689.1| thioredoxin-disulfide reductase [Blattabacterium sp. (Blattella germanica) str. Bge]
    MLKKIQDCVIIGSGPAGYSAAIYASRADLNPILFVGFQPGGQLTTTTNIDNYLGFPAGIGGIDFMENCKKQAERFNTKII
    NQSVTNVFLSNHKGGIHNIFFEKECIESRGLIIATGSRPKFLGIEKEKRLTGLGVSF
    CATCDGFFHKGKDVAVIGGGDTA
    LEEANYLSKICKKVYLIVRKNYLKASKILQFHLSKRSNVNVLFCSQITKIIGNDFLEGVQIFNHEKKMNTTLLVNGLFIA
    IGHIPNTEIFKNKLDLDDRGYVIVKKGSTMTNKPGVFAAGDVQDPNYRQAITSAGTGCMAALDLERYLYHEKM

    >gi|262340932|ref|YP_003283787.1| dihydrolipoyl dehydrogenase [Blattabacterium sp. (Blattella germanica) str. Bge]
    MSNVYDLVVIGSGPGGYVAAIRASQLGLRTAIIEKYQELGGTCLNVGCIPSKSLLDSSKYFSLAKNHYSSHGIFFEKLFF
    DFKKMMNRKNEIVKNINNGIKYLMKKNKIDLYQGIGSFKTMNILSIKEIKSLKEKQKIQFKYCIISTGSKPYCLPYLNFG
    NKIISSTQALSLKEVPNQLIIVGGGIIGLELGSIFNRLGSQITIIEGLDKIISNMDDSLSLEIQKILEKSSIKIKTSLSI
    TNIIEENNKKISVFVKYKNGEEMKFVGDYCLLSIGRIPYTKNLGLENIGIKKDQKGFILVNDSLQSNIQNIYAIGDVIGG
    KMLAHKAEEEGLYVVEHMIGQKPNKLNYDLIPSVIYTHPEVASVGLTENEIKKEKIEYNVGTFPMKVLGRARTSGCTDGF
    LKMISHKKTDEILGVHIIGDHAADMIMEASVAMEFRASSEDIYRICHPHPTFSESFKEAALLSLENRSIHI

    >gi|262340991|ref|YP_003283846.1| dihydrolipoyl dehydrogenase [Blattabacterium sp. (Blattella germanica) str. Bge]
    MHFDVIILGSGPGGYVASIRAAQLGMKTALIEKESLGGVCLNWGCIPTKSLLNSAKILQSIKKDGKLFGIKNEQIQIDYP
    KIISKSRNVVEKMRKGISFLMKKNGIHVIDGNGILKKGKKIEVFENEKNVAEYSASHIIISTGAIPKIEEEFKYDGKKVI
    TYREALSLSFLPKRMIIIGSGSIGLEFAYFYHSMGTHVTIIEICTKLFPNGDEEISDHLKYSFEKMGIKCYTSSSIKKIE
    THDDRIIVEIKYSSENIFLEAESVLYAIGIVPNIKSIGLEEIGIQIDKGFIVVDENYQTNVDGYYAIGDVIKTPSLAHVA
    SHEGINCIENIKGLNCQKIDYNNIPKCVYSFPEIASVGYTEKESKEKGFQIKVAKFPFSALGRAISDENTDGFIKVIFDA
    KYDEWLGCHMIGNNVTDLISEVVVARKLEATSYEILGSIHPHPSLSESIFESVANAYGRAIHL

    >gi|262341089|ref|YP_003283944.1| thioredoxin [Blattabacterium sp. (Blattella germanica) str. Bge]
    MLQEINDENFEKLVYESDKPILVDFWAPWCSPCRALSVLLEDIFTEYHNKALIFKLNVDKNPKFSSKYGIRSIPTMIFFK
    NGEKKDMHIGIASKEDIRKKLDALISQ

    >gi|262341115|ref|YP_003283970.1| peroxiredoxin (thioredoxin peroxidase) [Blattabacterium sp. (Blattella germanica) str. Bge]
    MKTLISKKAPNFTASAVLNGKNIVQNFTLEQFYGKKYVLLFFYPKDFTFVCPTEIYAFQEKIKDFETRNVQIIAVSTDTE
    QSHWAWLQMPKEKGGIYGVTYPIVSDINKTISHNYGVLSGDWILDSNEGLKATGELIAYRGLFLIDKEGIIRHILINDFP
    LGRNVHEAIRMVDSLQYYEKSGEVCPANWTIGKKAMKASHSGIVDYFSS

    >gi|262341233|ref|YP_003284088.1| putative thioredoxin family protein [Blattabacterium sp. (Blattella germanica) str. Bge]
    MVRTYSSSEMKIQIKDFNLLEVSSGKKKFLKDFFSDKATVIMFICNHCPYVKHINAELVRLSNDFIPKGISFLAINSNDA
    NKYPEDSPENMKKIHHQLGYPFPYFFDETQDVAKYYGAKCTPEFFIFSGKGNLCYHGQLDDSRPGHKIPVTGSDVRNVLQ
    NILTGININPTYKLSYGCNIKWKT