Bifidobacterium dentium Bd1 uid43091

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|283455092|ref|YP_003359656.1| thiamine biosynthesis protein ThiF [Bifidobacterium dentium Bd1]
    MTFEPSATPEQIQARQTAFNGLPDPATLVSREEIRAALLDRHTAATQDKLDAARVAICGCGGLGSTIAVALTRIGVGHLH
    LIDFDRVDMTNLNRQQYFLKDLGQYKTEALRSNLRQINPFIDITVDTVKVTDENVPTLFEHEDIICEAFDVPENKTMLVN
    AVLENLPSKKLVSASGMAGFRSSNLVSTRRVSKNFYFCGDGETAPVPGAGLMAPRVGVVA
    CHEANMITRLILGEEDA

    >gi|283455771|ref|YP_003360335.1| ogt O6-methylguanine-DNA methyltransferase [Bifidobacterium dentium Bd1]
    MDKFKTHYDSPIGGITMIADGEALLGLWFDGHTEDADDDNAVWTDDLPIFGLAFRWLDEYFAGRKPKVHVPIRLEGTPFR
    EEIWALLREVPYGETVSYGELAHRLESKHADGRKVSARAVGGAVHHNPVGIIVP
    CHRVIGADGSLTGYAGGLDVKARLLR
    LEGVLEKPD

    >gi|283456183|ref|YP_003360747.1| pdhD Dihydrolipoamide dehydrogenase [Bifidobacterium dentium Bd1]
    MAQEHFDIAIIGGGPGGYSTALRAAELGKSVVLIERDATLGGTCLNRGCIPSKTLLTATHAVENMRHAKAMGINVSVESI
    DFGKLRTFRTQTVDTMTKGLAGLLAHRGVTIVRGEAVMQP
    CGSVHVTPVEGLGHILRFVKAGVGEPIDGELEIVAEDIVI
    ATGSRPSPLPDNPFAGALIDSTQALELDTFPSSAVIIGAGAVALEFASMWRTAGCDVTLLIRKDRVLSAWERRTSATLTR
    ELKRRGVNIITHSHVTHVETGANLGATVHYTREGSEADMSAYGEVVLAAIGRIPNTDADWFEACKLERDARGFIGIDAFG
    RTNLDHVWALGDITSGHSLAHRAFEQGIVIAEKIAGLDPKPVDDDTIPQVVFSFPEAACVGLSLDEARARKDVVNAQETV
    YPMLSNSRMLMSGSGGSLSIVSGAYADNPEVPLVLGAHIVSPIASDLIAEAEQLVGNHVPLHDAARLIHPHPTFSETFGE
    ALLKADGRPLHTR

    >gi|283456659|ref|YP_003361223.1| Thioredoxin [Bifidobacterium dentium Bd1]
    MATHAVTSENFNEVIEGNDLVFVDFWATWCGPCRAFGPTFEKASEANPDIYFAKVDIDQNPDLAQAAKVQAVPTLMVVKK
    QQIVFQQAGALRASDLDDLIGQAKALDVNAAASGRTGAEQ

    >gi|283457081|ref|YP_003361645.1| trxB2 Thioredoxin reductase [Bifidobacterium dentium Bd1]
    MEYALSSYGMARRKCSYGGTMSDLRDVVIIGSGPAGYTAAIYLGRAGYRPLVIAGALTPGGQLVNTTEVENFPGFPDGIL
    GPDLMDNMRKQAEKFGAEIIWDDVVSVTVDVESDTKTVTLDQGDIYQTRAVVVATGSQYRKLGVPGESEFSGKGVSY
    CAT
    CDGFFFRDKPIVVIGGGDSAFEEADFLSRFGSSVTLIHRRDSFRASQIMVERAKNNPKIDFILNSVIEEINGNDNGVNSI
    SIRNLKNESVEVISANGVFVAIGHTPATTFLDGVVNRDEAGYIQVEGASTRTSAPGIFAAGDCVDSVYRQAISAAGMGCR
    AALDAQSYLQ