Bifidobacterium adolescentis ATCC 15703 uid58559

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119025108|ref|YP_908953.1| thiamine biosynthesis protein ThiF [Bifidobacterium adolescentis ATCC 15703]
    MTFEPSASQAQIDARQHAFDNQPDPATLVSREEIRAALLDRHTAATQDKLDAAHVAICGCGGLGSTIAVALTRIGVGHLH
    LIDFDRVDMTNLNRQQYFLKDLGQYKTEALRSNLRQINPFTDITIDTVKVTDENVPTLFENEDIICEAFDVPENKTMLVN
    AVLENLPGKKLVSASGMAGFRSSNLVSTRRVSKNFYFCGDGETAPVPGAGLMAPRVGVVA
    CHEANMITRLILGEEDA

    >gi|119025652|ref|YP_909497.1| putative 6-O-methylguanine DNA methyltransferase [Bifidobacterium adolescentis ATCC 15703]
    MPSAIYKRDNMCRKTKSAIHRRDRCFVEGWRTVVKTKSHYDSPLGGITLIADETALLGLWFDWQPGYADDDSAVLGDSPT
    IGAAKRWLDEYFAGCIPRTEVPLLLEGTPFRKEAWALLRKVPYGETVSYGGLARRLELKRADGRRVSARAIGGAVHRNPI
    ALIVP
    CHRVVGADGSLTGYAGGIETKIRLLQLEGVLKQTERMDVDCESIDRIWRSTR

    >gi|119025963|ref|YP_909808.1| dihydrolipoamide dehydrogenase [Bifidobacterium adolescentis ATCC 15703]
    MRANESMRNELGFNMVQQHFDIAIIGAGPGGYSTALRAAELGKSVALIERDGTLGGTCLNRGCIPSKALLTAVHSVETIH
    NAERMGINATLQSIDFGRLRDFRVSTVETMTKGLTGLLAHRGVTVFRGCAALQNAHTVRVTPAEGETQVSRSVEAGVFEP
    VETELAIDADDVVLATGSRPLALPGNPFAGALIDSTQALELNTLPSSAVIIGAGAVALEFASLWNAAGCEVTLLIRKDRV
    LSTWERRASMTLTRELKRRGVNVIARTAVDRVDTGANLGATVHYRQGDSDEDRTAYGEVVLAAIGRVPNTDADWFRSSGL
    KLDERGYVTVDGYGRTNLDGVWALGDITPGHALAHRAFEQGITIAEKIAGADPKPVLDDTVPQVVFSFPEAASVGLTLDQ
    AKAREDVVEPKETAYPMLSNARMLMSGEGGSMTVVSGAFANNPDMQVVLGVHIVSPIASDLIAEAEQLVGNRVPLADAAR
    LIHPHPTFSETLGEALLKADGRPLHTR

    >gi|119026367|ref|YP_910212.1| thioredoxin [Bifidobacterium adolescentis ATCC 15703]
    MATHAVTSQDFNQVVESNDLVFVDFWATWCGPCRAFGPTFEKASEANPDVYFAKVDIDQNPDLAAAAKVQAVPTLMVVKK
    QQIIFQQAGALRASDLDDLISQAKALDMDAAASDGDTASSGDAKVKTPSSQSER

    >gi|119026641|ref|YP_910486.1| thioredoxin reductase [Bifidobacterium adolescentis ATCC 15703]
    MSDMRDVVIIGSGPAGYTAAIYLGRAGFEPLVVAGALTPGGQLVNTTEVENFPGFPDGIMGPDLMDNMRKQAERFGTHIV
    WDDVVSVASNADSGIKTVTLDDGDVYDARALVIATGSNYRKLGVPGETEYAGKGVSY
    CATCDGFFFRNKPIVVVGGGDSA
    FEEADFLSRFGSSVTLIHRRSTFRASRIMVERAQRNPKIDFMLDAVVQEIRGDENGVQKVEVRNTATEKTSVIPANGVFM
    AIGHTPATAFLNGLVDVDSAGYITVDGASTRTSEPGVFAAGDCMDSVYRQAISAAGMGCRAALDAQAYLDSLK