Beutenbergia cavernae DSM 12333 uid59047

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|229818596|ref|YP_002880122.1| glutaredoxin-like protein NrdH [Beutenbergia cavernae DSM 12333]
    MSITVFSKPACVQCDATHRALRKHGLDFTVVDLTMDAEALESVKALGYQQAPVVLANGDHWAGFRPDKIRALAEGAGSVA
    AVA

    >gi|229818826|ref|YP_002880352.1| DSBA oxidoreductase [Beutenbergia cavernae DSM 12333]
    MPGVSAIKVDIWSDIACPWCYIGLRRFQAAVDVDDVDVDVEFHSFDLAPDTPVDFDGSEVDFLAGHKGMPVAQVEQMLEQ
    MTLLAATEGLTYDFDAVRHTKTLAAHELLHHAKAHGTQLELKERLFAAYFTEGRHIGHTEELLALAADVGLDPEAARAAL
    EDGRYRDEVQADIAQARAYGITGVPFFVVDGRYGVAGAQESAVFRQVLAQAAADRASAERPAPAPAPDEAATAVASA

    >gi|229818868|ref|YP_002880394.1| thioredoxin [Beutenbergia cavernae DSM 12333]
    MATRELTGETFESAVTDNDIVLVDFWATWCPPCKQFAPTYESASEQHTDIVFGKVDTDAEQDLSMQFGIRSIPTLMAFRE
    QVLVFSQPGALPPAALEQVITAVKELDMDDVRAKIAEQETAQA

    >gi|229819006|ref|YP_002880532.1| dihydrolipoamide dehydrogenase [Beutenbergia cavernae DSM 12333]
    MATHYDVVVLGAGPGGYVAAIRAAQLGKSVAVVEKKYWGGVCLNVGCIPSKALLKNADLAHTLNREKAKYGIEGDATMAY
    GPTHARSRQVSAGIVKGVHFLMKKNKITEIDGWGTLTGPKAMDVALNDGATEQLTYDDLILATGSVTRMLPGVEVSENVV
    TYEEQILDADLPGSIIIAGSGAIGVEFAYVMANFGVDVTIVEFLDRMVPLEDPDVSKELAKHYKKLGVKVLTGTKVESVE
    DTGSGVKVTVSANGEQQVLEADRLLSAIGFAPRTAGFGLEAVGVKLTDRGAVEIDDYMRTNVPGIYAIGDVTAKLMLAHV
    AEAQGIVAAETIAGAETMPIDYRFIPRATYCHPQIGSMGLTEQQAKDAGHEIKVAQFPFSANGKAQGLGDGIGFVKIVAD
    AEHNEILGAHMIGPDVTELLPAINTAQTWDLTADEMSRVVFAHPTLGEAVKEAFHGITGHMINL

    >gi|229819276|ref|YP_002880802.1| methylated-DNA/protein-cysteinemethyltransferase [Beutenbergia cavernae DSM 12333]
    MSTSVRFPRTLTIGPDDDAATTARAAARASSGLRHATNAVLVPTPIGPLLLTGAEALTAVWFSPSSEDMAAVRSSGALAV
    DPEDAPPVLREAMRQLAEYFSGTRREFDVPLAPAGTPFQLRVWDLLREIPYGETRSYGDIAAALGDPGSSRAVGLANGSN
    PLSIIVP
    CHRVIGADGSLTGYGGGIDRKRFLLELEGALEPALF

    >gi|229819570|ref|YP_002881096.1| peptide methionine sulfoxide reductase [Beutenbergia cavernae DSM 12333]
    MFFSRAVTMIEPEQALPGRTEPAFDVPGTHRVLGTPLRGPWPEGTQVLYVAMGCFWGEEKHFWEQPGVVTTAVGYMGGFT
    PNPTYEETCTGRTGHTETVMVAYDPSVVSTERLLEIFWTQHDPTQVFRQGNDQGTQYRSAVYWTTPQQRDLIERTKADYQ
    PQLTAADYGAIATEIRSADDAGPFFYAEGYHQQYLVANPNGYCPVHATGVTFANA

    >gi|229819582|ref|YP_002881108.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Beutenbergia cavernae DSM 12333]
    MRSLARVDTYDVVVIGAGPAGTAAALRAAELGARVAVLEADRVGGTCVNSGCVPTRVLAKTARLVREVRTADRYGIGAGP
    GLVDWPTTVARVHATVDRVRGLKREAERFAEAGVTLVLEGRARFVDDVTLELASGRRVRGSSIVVCVGGRSRRLPIPGAE
    LATVPEDVLALPALPRRVAIVGAGSTGAQLTTIFSAFGSEVTLLDVAPRILATTDDDVSRAVADAFRSQGVDVRTGLDGV
    TALEREADGTIRLTSVEDGAPSRDRFDAVVMATGWPADVADLGLENAGLSLTNGAIAVDRYFRSAVGHIFAAGDANGRDL
    LVQAAHFEAEAAAENAVLGVNRRTPGHLLPSGGFTDPDYAGVGMTEAEARRRDPLCLVATVPLAELDRAVIDDRETGFLK
    LVADRRREVILGAHAVGENAVEIVQSVTTAMAAGVDLATLADVRFAYPTYGAIVGLAARALLAEPPAAA

    >gi|229819918|ref|YP_002881444.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Beutenbergia cavernae DSM 12333]
    MSERDDVADVVVIGGGAAGLSAAVNLGRARRSVVVVDAGRPRNAPAEGVHAFLTRDGTPPAELLAAGRAEVERYGGRIVR
    AAVREAAGTVGDFTVSLDDGGRVRARRMLLATGVRDELPDVPGLRARWGRDVVH
    CPFCHGWEIADRRIGVVGSPMAVHQA
    LLFRGWSDDVTLFLRDAIEPSEEEWAKLAARGIAVVDGALAAVEVTGDAVTGVVLADGTVRPVDALVVAPRVHADVVPGL
    GVAATEHPAGVGTYVATDQVGATSVPGVWAAGNLADPMAQVIQAAAAGTRAGAAIVADLLEEELREALSSARGLALSP

    >gi|229820187|ref|YP_002881713.1| UBA/THIF-type NAD/FAD binding protein [Beutenbergia cavernae DSM 12333]
    MDGARTPLDADYLQRHVRQLMLPGYDVATQERLQGARVLVVGAGGLGCAVLPQLVASGIGTIGIVDDDVVETSNLARQTL
    YGPADVGTPKVEAALAQLGRLAPDARLVGHRTRLDATNDGELLSGYDLVVDGSDNFPTRYLVDDAAAALGMPLVWGAVHQ
    FAGQCGVAWAPDHPTYRDLFPREPAPGEIPS
    CAEAGVLPGVCATIGALLATEAVKVLTGVGDPLLGRVLLYDARRAELKE
    VAYRAATGGRAGAPPAAAPPGPPPSVPAAPSAPAAPSARAVPAASAREPRALTPHELAALRADDAPPLVLDVREDWEISL
    AALPGTRNVPLRELPQRIDEIPADADVVVL
    CHHGVRSEQAARFLLAAGRSRVSHLAGGIDAWSRTVDPGVRRY

    >gi|229820304|ref|YP_002881830.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Beutenbergia cavernae DSM 12333]
    MPRQPDLPDLPDLPALGTTAPPFRVTDVTGAPITGADLLGRPALLVFFPFAFSGVCTSELTELSAALPQLAPTRVLGISC
    DPTFSQAAWAREAGVAVELASDFWPHGATATAFGAFDESHGWAHRVSVLLDGDGVVRWRTASPPGRPRDAAEAVAAVDGL
    RAP

    >gi|229820355|ref|YP_002881881.1| dihydrolipoamide dehydrogenase [Beutenbergia cavernae DSM 12333]
    MAPSAPADAGERGDATYDVVVLGGGSGGYAAALRAAQLDLRVALVESDKVGGTCLHRGCIPTKALLHSAEVADAVRESAT
    FGVRASLDGIDMAAVTAYQEGVVARLYKGLQGLVAGRGIEVVAGHGRLVAPDAVEVAGRTIRGRNVVVATGSYSRSLPGL
    EIGGRVVTSDQALRLDWVPQRVVVLGGGVIGVEFASLWRSFGAEVTVVEALEHLVPNEDVALSTALERAFRKRGIGMRLG
    ARFAGVDQDDSGVRVHLEDSDDVLAADLLLVAVGRGPATAGVGLEQQGVELDRGFVVTDERLRTTTSGVYAVGDVVAGLQ
    LAHRGFAQGIFVAEEIAGLAPAPIVESGIPRVTYSDPEIASVGLTEAQARDRYGDGVETLEYNLGGNGRSQILRTAGFVK
    LVRAPEGPIVGVHAIGARMGEQVGEGQLIVNWEAFPEDVAALVHAHPTQNEALGEAALALAGKPLHAHH

    >gi|229820375|ref|YP_002881901.1| iron-sulfur cluster assembly accessory protein [Beutenbergia cavernae DSM 12333]
    MTESLTTEVETTHEVELTDVAAAKVKALLEQEGRDDLRLRVAVQPGGCSGLIYQLYFDERVLDGDALRDFDGVEVVVDKM
    SVPYLVGATIDFADTIEKQGFTIDNPNASGSCACGDSFH

    >gi|229820599|ref|YP_002882125.1| putative thioredoxin [Beutenbergia cavernae DSM 12333]
    MLDLATVSGRLTLAAVVLLAATLGWLLLQRGRGRATPVREARPDDRLAGLLAATGVPAGRRATVVQVSAAACAPCRQAAR
    VWASLAREDASVTHVELDVEDHAELVGRLHVLRTPTSFVFDGDGRLVSRVAGAPSPGQARDAVRPLREAAAA

    >gi|229820673|ref|YP_002882199.1| OsmC family protein [Beutenbergia cavernae DSM 12333]
    MPTPVVSTASTVWTGDLFHGAGRTSLDSSGLATFDVGWKSRSEGHEGQTTPEELIAAAHASCYAMAFSNELASNGTPPTQ
    LDTKAAVTFVAGEGITGIALSVRGQVPGISAEDFARIADAAKAG
    CPVSKALAAVPITLDAALA

    >gi|229820719|ref|YP_002882245.1| OsmC family protein [Beutenbergia cavernae DSM 12333]
    MAPRIGRASWRGALREGSGTVTVGERAWTSPYSFGSRFADGPGTNPEELLATAHAGCFTMALTHVLEAAGVTPQEVSTSA
    HVALRMVSGTPTIARIDLSTAVVAEGLDGARLQELADTAKEG
    CAVSRALAGVAEITVTARLAAAVDPVGSEV

    >gi|229821110|ref|YP_002882636.1| hypothetical protein Bcav_2629 [Beutenbergia cavernae DSM 12333]
    MTTTQERLTDEQDTAAAVADFWFDPLCPWAWMTSRWIREVEKVRDISVRWHIMSLAVLNEDKDIDAGYRAFLEHAWGPAR
    VVNAARELHGDDVVGPLYTALGTRIHPGARKDYDAVIAEALAEVGLPADLARYADSDELDTSLRASHDAGISQVGEEVGT
    PIVAFNGTAFFGPVITPAPKGEEAGRLWDGCVLVAEFPGFYEIKRTRTQGPIFD

    >gi|229821133|ref|YP_002882659.1| Rhodanese domain protein [Beutenbergia cavernae DSM 12333]
    MSVETDTTTAKFTEYAHPERLVSTQWLADHLGAAGLVVVESDEDVLLYETGHIPGAVKIDWHLDLNDPEIRDYLDGEGFA
    RLLGSRGISRDTTVVIYGDKNNWWAAYALWVFSLFGHTDVRLLDGGRDRWIAEGRPITTVAPEPTAAEYPAVERDDATIR
    AFRDDVLAHLGNPLVDIRSPQEYTGERVSMPDYPEEGALRGGHIPTARNVPWARAVAEDGTFRPREELEAIYGAGGLGLG
    SDPVITY
    CRIGERSSHTWFVLTHLLGLADVRNYDGSWTEWGNAVRVPIVKGAEPGAVPHARSAAAV

    >gi|229821153|ref|YP_002882679.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Beutenbergia cavernae DSM 12333]
    MPKLAVGDVAPDFTLPAAGGGDVSLASLRADAEKGVIVYFYPAAGTPGCTTQACDFRDSLASLQGAGYAVVGLSPDTVGA
    LEKFADAESLTFALGSDPGHAVLEAYGAWGEKTLYGKTVVGVIRSTIVVAPDGTVSLAQYNVKATGHVAKLRRDLGID

    >gi|229821379|ref|YP_002882905.1| glutaredoxin-like protein [Beutenbergia cavernae DSM 12333]
    MTQATPETGTVTMYSTTWCGYCRRLKSQLDREGIAYTEVNIELEPEAASFVEQVNGGNQTVPTLLFPDGSSATNPSLAEV
    KQRLGV

    >gi|229821549|ref|YP_002883075.1| Rhodanese domain protein [Beutenbergia cavernae DSM 12333]
    MSDVLVSATDLYTRLSSAREKDPVLLDVRWTLAEPDGRRAYSAGHLPGAVYVDLEHELAGPGSPEAGRHPLPTLADLQAA
    ARSWGVDDGADVVVYDDAGGTAAARAWWLLRWGGHPSVRILDGGLAAWARVGGILEDGDVRPHVGDVELAGGGMPTIDAD
    GAAAWAGILLDSRAGERFRGESEPIDPRAGHIPGAVSAPTSDNLDPAGRFLGAEALRARFAALGIDGDVPVAAY
    CGSGVT
    ASHEIAALAAAGIPAALYPGSWSQWSNDPDRPAATGA

    >gi|229821733|ref|YP_002883259.1| Redoxin domain protein [Beutenbergia cavernae DSM 12333]
    MRKGLVRLAVAALAAAALLAGCTTGDDGGPVAGDEVPDAGYQAGDGTFTSWAEGERSAAVEADGTTFEGEAVDLADWRGD
    VVVLNFWYAA
    CPPCRAEARDLAEISDDYAADGVRFLGVNGTDDTDTALAFQTTFDVPYPSLDDRDAAVVAALEGVVPLRA
    MPTTVVLDAEGRPAARVIGIADPTTLRLLIDDVLAEAA

    >gi|229821737|ref|YP_002883263.1| glutaredoxin 2 [Beutenbergia cavernae DSM 12333]
    MRRMTAPIGSPDVPAPPDVRVLLLERTGCHLCAEAREVLAGVCGPRGIRWVPVDVDESADLVAAYGELVPVVLVDGVPRG
    QWRIDPAKVAAAVDVTGS

    >gi|229821959|ref|YP_002883485.1| methionine-R-sulfoxide reductase [Beutenbergia cavernae DSM 12333]
    MTEHVTKSDDQWRAELAPAEYAVLREAATERPWTGELLDEKRVGVYSCRACGAELFRSTTKFDSHCGWPSFFAPQDSDAV
    ELIEDRTLGMVRVEVRCATCGSHLGHVFDDAPQTPTGDRY
    CMNSIAMTFAPSA

    >gi|229822040|ref|YP_002883566.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Beutenbergia cavernae DSM 12333]
    MDSSLTTDVVVLGGGPTGENVADYAHKGGLDAVIVERDLLGGECSFWACMPSKALLRPGDALAGVRRVDGARQAVRGGLD
    VAAVLARRDGFAAGWDDAGQVAWAEGAGLRVVRGHGRVTGERVVTVGTPDGGEVTIEARHAVVVATGSVPVIPSLDGLDE
    APFWTTREATAAQSVPGRLVVLGAGVAGTELAQAFARLGSDVTLLARDAVLRAFAAPARELVAAGLQADGVDVRLGVSVR
    RVERRVGANDDEPGGVLVHLDDDSTILADELLVATGRRPATGDVGLEWARPGLEPGDPLDVDDSGRVPDVPWLYGAGDVT
    GRAPLTHQGKYAARAVGTAIAQRAAGKLDGAVEAWSDVAATADGVAVPQVVFSDPQVASVGHSADAARDAGLQVRTVELE
    IAVAGSSLYADDYAGWAQLVIDDARDVVVGATFCGPDVAELLHAATIAVVGEVPMSRLWHAVPAYPTVSEVWLRLLEADR
    FR

    >gi|229822183|ref|YP_002883709.1| protein of unknown function DUF255 [Beutenbergia cavernae DSM 12333]
    MANRLAHSLSPYLRQHADNPVDWWEWGDDAFVEAARRDVPVLLSVGYAACHWCHVMAHESFEDADTAAGLNDRFVAIKVD
    REERPDVDAVYMAAVQGLTGQGGWPMTVFLTPTGEPFYAGTYYPPEPRHGMPSFRQVLDAVAEAWTDRRDGVVEQARAIA
    GAIGADDGGAVGARRPIVAVRASEPALDAAALDAAAATLAAEFDARHGGFGGAPKFPPSMALELLLRHHARTGDDASLAM
    VASTCEHMARGGIHDQLAGGFARYSVDATWAVPHFEKMLYDNAQLLRLHAHLHRSAEPGGPTAELARRVATSTAEFLLRD
    LRTGQGAFASALDADAPAEPGGRPEEGVSYVWTPVQLVDVLGEDDGAWAAAALGVTEAGTFEGGASTLRLPADPDDGERW
    LRVRATLLAARDTRPQPARDDKVVAAWNGLAIAALAEAGALLDRPDWVDAAVACAELLVNVHLDDGRLRRVSRDGVPGTA
    AGVLEDYADVADGFLALLQATGDPVWLTRAGALLDVVLDRFAAPGGGFFDTADDATDPRLATIRRPADPSDNAAPSGSSA
    AAGALLSYAALTGSRPHRAAAEAALAAVAPLAERAPRFAGWALAVAEAALAGPAEVAVVGPGDDPRTHTLLAAARGAGAP
    GAVVVAADPDDLGADAVPLLRDRPLLDGAPAAYVCRQFVCARPTGDPDELVALLDARHSPPSA

    >gi|229822379|ref|YP_002883905.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Beutenbergia cavernae DSM 12333]
    MPATTRLPRVRASELVGRGWLGTGGRELSLADLRGRVVVLDFWTFCCINCLHVLDELRELEEARRDVLTIVGVHSPKFVH
    EADPEALAAAVDRYEVRHPVLDDPELVTWSAYGARAWPTLVVIDPEGYVVAQMAGEGHASALEALVDELVEEHRAKGTLR
    TDDDGGPYVPPSPTPGTLRFPAKAIALENGNLLVADAGHHSLAELGPDGETLVRRVGSGERGLVDGGPNVARFSEPNGLC
    LVPVELRARLGYDVLVADTVNHALRGVRLADGHVSTVAGTGQQYVVGAPDNASDPHGGTHPVGFGDQFVPTSVKLSSPWD
    VAWSPDLAAFVVAMAGNHTLWAFDDEQGSLTRLAGTEHEGLRDGPAAEAWFAQPSGLAVAQDGRIWVADSETSALRWLDP
    AGGDVHTAVGQGLFEFGHRDGAADQALLQHPLGVAALPDASVLVADTYNGALRRHDPATGVVTTIATGLAEPSDVVVLQA
    SDDDGGPAVLVVESAGHRITRVALPAELRGSLHDGAAHRTQRPVTELAAGALRLEVPFLPAPGQKLDDRYGPATRLQVSA
    TPPELLVSGAGDDVDLARDLVLAPGEGVLHVTAQAASCDADPAIEYPACHLAQQDWGVPVRVVARTDDDDAAEPLVLPLR
    G

    >gi|229822495|ref|YP_002884021.1| heavy metal translocating P-type ATPase [Beutenbergia cavernae DSM 12333]
    MAAASFQSAPGVIELEVGGMTCASCAMRIEKKLNRLDGVEATVNYATEKATVTAPEGYDPQLLIAEVEKTGYTAQVPVPP
    SSATADDDDADRPDPELTSLRQRLVGAVVLSVPVIVLAMVPAWQFTYWQWASLALAAPVALWSAWPFHRAAWLNLRHGAA
    TMDTLVSVGVLAAFGWSLYALFLGTAGEPGMTHGFELTVGRSDGAANIYLEVASGVTMFVLAGRYFEKRSKRQAGAALRA
    LLQLGAQEVAVLRGGAETRIPIDQLVVGDEFVVRPGEKIATDGVVVAGASAVDESMLTGESVPIEVTEGDAVVGATVNAG
    GRLVVRATRVGSDTQLAQMARLVEAAQSGKAEVQRLADRISGVFVPIVVAIAVGTLGVWLGGGFPATAAFTAAVAVLIIA
    CPCALGLATPTALLVGTGRGAQLGILIKGPEVLESTRRVDTIVLDKTGTVTTGRMTLTAVVADDGVDRTELLRLAGGLEH
    ASEHPIARAIASAAADEVGELPTPDGFTNLGGLGVRGTVEGRAVVVGRASLVAGSGRATGGAEGTSDDGGTTPEADLPPA
    LAAAQASAERDGRTAVVVGWDGAARGVLVVADAVKPTSAEAVRQFRILGLTPVLLTGDHRAVAEQVAAEVGIERVIAEVL
    PEGKVEAVAALQAEGRVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEAADLTLVRGDLRAAADAIRLSRRTLGTIKGN
    LFWAFAYNTAAIPLAALGLLSPMLAGAAMAFSSVFVVGNSLRLRSFASRATDGAGAR

    >gi|229822531|ref|YP_002884057.1| methylated-DNA/protein-cysteinemethyltransferase [Beutenbergia cavernae DSM 12333]
    MTHATQPPFLSAGLADAVGIPAGNLPAGAGAVPEHLTAALAAAAARDGVLDVAYRTLDTPVGPLVLAATGAGLVRVAFAR
    DGAEPTLEELAERVSPRVLLAPARLDAVARELDEYFAGRRHVFDLPLDLQLLRGFRRSVVEHLEEIPYGRTASYGEVATI
    SGRPRAVRAVGTACALNPLPIVLP
    CHRVVRSDGSMGGYAGGPDAKRTLLTLERERNEFGRTG

    >gi|229822686|ref|YP_002884212.1| thioredoxin reductase [Beutenbergia cavernae DSM 12333]
    MPQDAQVREVIIVGSGPAGYTAAVYAARADLRPLVFAGSVTAGGALMNTTDVENFPGFPDGVLGPELMEKLSAQAERFGA
    EIVYDDIESVDLAGEIKTVTNADGETFRARSVILATGSAYKELGLPEEKRLSGRGISW
    CATCDGFFFRDQHIVVVGGGDS
    AMEEATFLTRFASKVTLVHRRGELRASKIMAARAEADPKIEFAWHSEVAAIHGDDKVTGVRLRDTRTGEERELDATGVFV
    AIGHLPRTELVSGQIDLNAEGYIEVTHPTTATNLPGVFAAGDAVDHIYRQAITAAGTGCAAALDAERYLAALGEAGDPDR
    DAAQTPDPDGHVVAADATPAVVVG

    >gi|229822687|ref|YP_002884213.1| thioredoxin [Beutenbergia cavernae DSM 12333]
    MSTVTAVTDDTFATDVLQADGVVLVDFWAPWCGPCRQVAPVLEDIANELDGQVTVVKVNTDENPSTTAAYGIVSIPTLNV
    YSGGELVKSLVGARPKKAILAELEQLLPA