Beijerinckia indica ATCC 9039 uid59057

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|182676976|ref|YP_001831123.1| hypothetical protein Bind_3850 [Beijerinckia indica subsp. indica ATCC 9039]
    MRSIPVALFCLMPFAAAGSDLSELKQPSERVVEEPTLPPLVPGLSDRPSTPYRSEGINPDLPVLKHIAESGAKLSELGAM
    HGLQRVLVRRDKQFMILNVTPDGEAIIAGLQSDFPFDELKKSLPIDVTELQDTHAIKGLFVRNGHEFQVLYLTPDGQNVI
    PGVMWDATGHNITRDQVSSIEGAIPRVEIKNDTMPAVAVSALDGKPSLSVVKETSFGTYGRSGAPRLWIFVDPL
    CSFSIR
    AMDQLRSYATRGEIELAVVPVSIIDHEDGGKSTEHALSMLSLPRETMVAAWRNDQLNNPVAAEARDRLTINMAAAEVIHL
    RGTPTLLWQKEDGSEGRLDGLASDWDRVIASMRH

    >gi|182677014|ref|YP_001831160.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Beijerinckia indica subsp. indica ATCC 9039]
    MSKKLEAGDTAPEFHLPDDRGGTLSLADFAGKKLVLYFYPKDDTSGCTKEAIDLNGLKGDFDKAGTNILGVSPDSVASHV
    KFKTKHKLDLALGSDETKAMLETYGVWVEKSMYGRKYMGVERTTFLIGPDGKIAKIWRKVKVPGHAEAVLEAARALA

    >gi|182677058|ref|YP_001831204.1| thioredoxin reductase [Beijerinckia indica subsp. indica ATCC 9039]
    MSAASLSPLHARLIIIGSGPAGYTTAIYAARAMLEPVLISGIETGGQLMITTDVENYPGFAEPIQGPWLMEQMRTQAEHV
    GTKLIADHVIKVELGQRPFRLIGDSGQIYTADSLVIATGAKAKWLGLPSENTFKGYGVSA
    CATCDGFFYRGKDVFVVGGG
    NTAVEEALYLSNLASKVTIIHRGERFRAERILQERLFKQDNVEVLFNQAIEEICGTDQPLNVTHVRLKNTKTGAIETRET
    HGVFVAIGHQPASELFAGQLTMKANGYLWTAPDSTATNIPGVFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLLAEGEL
    RHAAAE

    >gi|182677094|ref|YP_001831240.1| peptide methionine sulfoxide reductase [Beijerinckia indica subsp. indica ATCC 9039]
    MWFHKKVTMPTAAEALPGRAEPMATAQTHFVNGHPLHPPFPAGYETALFGLGCFWGAERKFWQIGDAVFTTAVGYAGGFT
    PNPTYEEVCTGKTGHNEVVLVVFDPKRVTYSDLLRVFFENHDPTQGYRQGNDVGTQYRSGIYVFDEAQKQAAQTAKAAFE
    PALAAAGFGPITTEILDAPPFYYAEDYHQQYLAKNPDGYCGLGGTGVSCPIGTGVAAE

    >gi|182677105|ref|YP_001831251.1| iron-sulfur cluster assembly accessory protein [Beijerinckia indica subsp. indica ATCC 9039]
    MANSAFSILSLTDNAAARTRELLAQAGNADKLLKIGIKNGGCAGMSYTLDLIDELGPLDEIIEDKGVRLAVAPQDVMFLL
    GTQVDFVTDRLGSSFTFRNPNQTGSCGCGESVSITPAQPETARS

    >gi|182677267|ref|YP_001831413.1| heavy metal translocating P-type ATPase [Beijerinckia indica subsp. indica ATCC 9039]
    MASASILKLRVEGMDCGACALKIEAAMRSLPGVADIAVDYHKASLSLTLDEDRSSRAVIEARIRALGYTPIGDGVAVACE
    TDRDHGPRQDAWWASRKGRLVITTGVVLSLATIIAYRAPEWSYWAYGVATLAGLLPLSRRALAGARSGVPFSIETLMTIA
    TAGAIAIGEAQEAAVIVFLFAVGELLEGIAADRARTGIKALTKLLPRQALRLHGANVEMVSVETLAVGDHVVVRPGDRIP
    SDGFVVEGMSEVDEAPVTGESMPVAKETGAIVYAGSINANGELRVEITRTAADNTIARIIHKVEEAQASKAPTARLIDRF
    SRLYTPFAMAAAGFVVLMPPLFFGADWFLSIYRGLAVLLIACPCALVVSTPTAIASGLASGARHGLLIKGGAALETLSRV
    QTIAFDKTGTLTLGHPQVTDVLPIHGSVAEILVKAAAVERGSSHPLGVAIVAEAEKRHLALPECFGGGIAIPGKAMMGRL
    KSGFVWVESPRHAAAQTALADNNDDDIAARIAALEGEGKTVVVIRENKTILGLIALRDAPRSDAAEGLARLRALGLRLVM
    LTGDNGRAATTLGHVLGLEVKAELLPDAKLDAILTYKAEAPIAMVGDGINDAPALAAASVGIAMGCGTDVALETADAALL
    KNRVTGVAELVALSRATLAIVWQNIALALGFKSVFLATTLWGATPLWTAILADTGAMVLVTGNALRLLRFKVS

    >gi|182677322|ref|YP_001831468.1| glutaredoxin 3 [Beijerinckia indica subsp. indica ATCC 9039]
    MAEIEIYTTPTCDYCASAKKLFAKKGVTYTEIDVSGSKDLRKAMTKRANGGDTVPQIFIDGKHIGGYDDMYALDRKGLLD
    PMLGKTA

    >gi|182677394|ref|YP_001831540.1| iron-sulfur cluster assembly accessory protein [Beijerinckia indica subsp. indica ATCC 9039]
    MDDLNVTITPAADKFVRRMLRFDGGPNSGLRLSVAPGGCSGLSAEFAVVDKPTASETVHETNGLRFFIDAQSKVLLQGVT
    MDFVETPTSAGLKFHDPKAVSTCGSHSAPSLDLHDHKH

    >gi|182677465|ref|YP_001831611.1| rhodanese domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MATYRRITIDEARSLMDAETKPVVIDVRDPASYQKGHIDGALRVDLTNLDTLLKETPKTKPVLIYCYHGNSSQAYAKAFG
    AADFADVFSMDGGYEEWRKAEMRQNAAPIEEAPTVEGLSDALEAFLKEHGYPKGGVNAVTPTDRMTPLMRACHLNAKAIV
    TELLQAGARVDASNNDQNQALWLACVGDDPDIVDMIIAAGADLNHANVNGSTALIYAASAGKAKALARLLAAGADLDYQV
    DGFSAIDMASTLECLNMMREAKRRAKAAKAGS

    >gi|182677466|ref|YP_001831612.1| rhodanese domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MTIGLPPANAADVILAYHQRTKHKMDRYAAGPETLDWSEQPNPFRDFAGAESKLLPLGAENITTPFANIYNPDRTPAAAL
    DETSVGALLQLSLALNAWKEYGPDRWAMRSNPSSGNLHPTEAYVLARNIPGLADGVHHYAPRNHSLEHRGSLSNATSGEP
    ALWIGLSSIHWREAWKYGERAFRYCQLDVGHAIGALRYAAGTLGWRLQMVEGLSSAEIASLLGLDRDADFTAGVEREAPD
    LILRVVTGPGVTALKGGDAGFLLDQLSVWQGRANVLDRHHMYKWPVIDEASAATKKTAPHEETPYRGNFPGIGEGSPEPA
    AKVILNRRSAQAFDRSARMGSGSFYHLIDRLLARPVAPWDVWTYAPRLHPVFFIHRVDGLEPGLYILLRNPDAEMRLKQA
    THQDFVWKRPEHVPPQLNFFQLLPTDCTKVARTLHCHQAIASDSCFALGMLAEFDELVHAEPWRYKQLHWEAGLIGQVLY
    LEAETLGFRGTGIGCFFDDAMHEILGLKDTRFATLYHFTVGLPLIDTRMLTLPPYGDRTEVEDTTQTQGIQTMAEEASFE
    RIGIDIARQLIADDKTLVLDMRDPGSYESGHIEGAEHVTESNLFHFLSTTPKDTPVLIY
    CYHGNSSQVYAKTFADFRFKT
    VYSLDGGYEGWRKANS

    >gi|182677467|ref|YP_001831613.1| nitrogenase-associated protein [Beijerinckia indica subsp. indica ATCC 9039]
    MQIIFYEKPGCSNNSRQKALLEAAGHELDVRNLLVEKWTAENLRSFFGDRPVADWFNKAAPQVKSGAVDPQNTDAETALA
    LMLAEPILIRRPLIEAAGQRAVGFDPAEMEAWVGLQAPRVQGVDLETCRRPKETAACPDKP

    >gi|182677479|ref|YP_001831625.1| iron-sulfur cluster assembly accessory protein [Beijerinckia indica subsp. indica ATCC 9039]
    MISLTDSALSAVKSALMRSGKEGAGFRVKAEAGGCAGYKYQIGLDAQSREGDTIVDAGDDVRVFVDSLSQPLLSGMQIDF
    VESLEGAGFVFENPNATNSCSCGKSFS

    >gi|182677594|ref|YP_001831740.1| alkylhydroperoxidase [Beijerinckia indica subsp. indica ATCC 9039]
    MARLIEEKDASEEVRTVYEDIKATRKTDWINNFWKAIAFHPPSLRLLWTQVKQVMAPGALDPLTKEMIYVAVSVTNNCRY
    CISSHTAAARAKGMTDEQWAELLAVVALANETNRLAIGYDVPVDEKFLQE

    >gi|182677702|ref|YP_001831848.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Beijerinckia indica subsp. indica ATCC 9039]
    MSEAPQKSPGPANRRSWLIFAPLLLFLAIAGLFLVRLFAGDASLLPSALIDRPTPTFALSPVEGLQDVTGLSNQDLAQGH
    VSVVNFFASW
    CVPCHQEHGVLMQLAADPTLQRAGLRLYGIAYKDKPENIRQFLNQRGGNPYAAIGNDAKGRVGIDWGLYG
    VPETYVVRGDGTIAYKFIGPLSDESLRETLVPEIKKADLGHHQF

    >gi|182677739|ref|YP_001831885.1| DSBA oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039]
    MTLPTPSMISPLAFSRRSLFTALALSLALAPLAASHATAQGTSIPTDQLMAPQALPDIALGSEQAPITIVEYASMTCSHC
    AAFHAETYPVLKSKYIDTGKVRFILREFPLDPLATAGFMLARCAGPDKREAMVDLLFAQQKNWAFVDKPLEALAALVKQT
    GIGQDRFEACLKDQDLFDKVNKVRDQAAEKFNVNATPTFFINGKKQNGEISPDALDALLQPLLKG

    >gi|182677874|ref|YP_001832020.1| glutathione-disulfide reductase [Beijerinckia indica subsp. indica ATCC 9039]
    MTDYDVDLFVIGAGSGGVRAARIAAGYGARVLIAEEFRVGGTCVIRGCVPKKLMVYASRFVDHFEDAAGFGWDVPQPSFH
    WSKLVAAKEKEISRLSAIYRTNLDKAGVTILDSRAEIEDAHTVLLKADERRVTAGMILVATGGTPVLEPDVPGRDLAITS
    NEIFDLPEMPKRLLIVGGGYIAVEFASIFARLGSKVTLVQRGDNVLRGFDEDMRNGVRDALIHAGVDVKSGFLPTAIEKR
    GDALHVSLTKGTHIEVDQVLTATGRRPHTLGLGLEKAGVIVDDIGAIKVDAYSKTNVDSIYAVGDVTNRLALTPVAIREG
    HAFADTVFGHKSTAVNHTNVATAVFTTPELGTIGLSEMEARAIYDCVDVYLASFRPLKATLSGRQEKTVMKILVDGQTDK
    VLGVHILGEDAGEMAQILGIAITVGATKADFDATMAVHPTSAEELVTMRVRTARYERAPQGLDEAPGAAD

    >gi|182677983|ref|YP_001832129.1| hypothetical protein Bind_0997 [Beijerinckia indica subsp. indica ATCC 9039]
    MTRFAFEHTYGRLPDRFFARVSPTPVASPRLIRLNEALATDLQLDAASLLSPEGAEIFAGNRIPDEAEPIAIAYAGHQFG
    QFVPQLGDGRAILLGELLDRRGIRRDVQLKGAGRTPFSRRGDGRATLGPVLREYLVSEAMAALGIPTTRALAAVVTGEMV
    PRETFLPGAVLTRVASSHIRIGTFQFFAARGDVEGLRALADHVIARHYPEAADKASPYLALLDAVIMALAALVAQWMSVG
    FIHGVMNTDNMSVAGETIDYGPCAFMDTYDPETVFSSIDHGGRYAYNNQAPIARWNLARLAETLLPLIADDQQQALPMAQ
    KSIGTFDAHFEAAYLAAMRRKLGLFTQQEEDKALIKTLFATMARNGADFTLTFRALSQAAASQDAEDRLRSLFKDPADCD
    AWIAGWRQRLAQEPQDPMERQQAMRRVNPAYIPRNHRVEAVIAAAIGQNDFSPFEKLLSIVTDPYSDQPDFSHYMEPPAA
    HERVLQTF
    CGT

    >gi|182678003|ref|YP_001832149.1| arsenate reductase and related [Beijerinckia indica subsp. indica ATCC 9039]
    MATIYGIKACDTMKKARTWLDEHGIAYAFHDYKTAGIDRDRLESWARAIGWEKLLNRAGTTFRKLPEQDKEGLNQDKAIK
    LMLAQPSMIKRPVLDLGDRLLVGFKPADYEGAMLPSSRS

    >gi|182678040|ref|YP_001832186.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Beijerinckia indica subsp. indica ATCC 9039]
    MKRSMPRFCLSLSLSLVVALIAASPAFASLKIGTRAPDFTVPAARAGQVFTFSLAEALQRGPVVVYFYPAAFTSGCTVEA
    HDFAEAMNDFEALGATVIGVSHDAIDTLSKFSVSECRGKFPVAADVDQAVMKNYDSVLIRNPLLAERTSYVIAPDGTILA
    VYSNSDPSEHVGKMLAALKAWKAKSPVP

    >gi|182678204|ref|YP_001832350.1| rhodanese domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MGDPAFFVSTEWLAAELGKSNSLQDLAIIDATFFMPDEKRDAKAEYIARHIPGAVYFDIDAIADHTTDLPHMLPSPEQFA
    EAAGKLGLAENIRLVVYDASGLLGAPRVWWTLRLFGARDVKILEGGLPQWIAEGRPVESGEVQPKPRTFTPTFDSAGVVN
    AATVNAASAGKTSQIIDARAAPRFRGEVPEPRAGLRSGHIPNSLNLPWREVVAEGRLKSPQDIEKAFSAIGFDPQQPVIT
    T
    CGSGVTAAILLLALENIGQRGIRLYDGSWTEWGGRNDLPIATG

    >gi|182678249|ref|YP_001832395.1| alkylhydroperoxidase [Beijerinckia indica subsp. indica ATCC 9039]
    MYDMANLKKLELLAKDAPAAMEAFKAFDKAAMADGAIPVKYKELIALAVALTTQCPYCLEVHKRGAERAGATQQEIAETV
    FVAMALRAGGALTHGTHIVHE

    >gi|182678262|ref|YP_001832408.1| ArsR family transcriptional regulator [Beijerinckia indica subsp. indica ATCC 9039]
    MLNDIKGNSVSSTGPKQAIYESLAEVAQALGHAHRLELLEHLAQGERSVEELSSRTGLTFANTSRHLQILRRARLVETER
    RGKHILYRLAGEAEIVALINALGRVGERNVAEIDRVKADYFLALDALEPVSRADLLSRLQDGLVTLLDVRPEDEFAAGHL
    PGALGIPLAELEHRLSELPQDREVIAY
    CRGPYCILSFEAVAALRARGYLVRRLEDGYPEWKAAGLPIETSA

    >gi|182678267|ref|YP_001832413.1| hypothetical protein Bind_1283 [Beijerinckia indica subsp. indica ATCC 9039]
    MSANELSQAASPYLLQHAHNPVHWRMWTKAALEEAQALNKPILLSVGYAACHWCHVMAHESFEDPETAAVMNELFVNIKV
    DREERPDIDHIYMSALQAFGERGGWPLTMFLTPKGEPFWGGTYFPKVESFGRPAFVTVLKTVAEAFDKQPERITKNTEVV
    REGLGKRPAGEEGAALSLEQMNNLAPQMVNFIDQVDGGLRGSPKFPNTPIFEFLWRAGARISKVPYRDLVRHTLDRMSEG
    GIYDHLGGGYARYSTDERWLVPHFEKMLYDNAQILELLALCFREFNDELFLTRARETVGWLHREMTSPEGAFCSALDADS
    EGVEGKFYVWVWEELVQTLGVEDAIYFGKFYNAGRIGNWAEEKHGAMVTILNRLESHRPSDEEEERLAPMRQKLFAVREK
    RVHPGLDDKIMADWNGLMIASLVNAATTFDAPEWITIAAKAYDFIISTMHFIDDQGIKRLAHSWRAGVLVTPAMALDYAA
    MTRAAIALHEVRNHPAVSDILIRDYLADAITFAEQLETYHQDPESGLLCMAAKDANDVILRLSPTSDDAIPNAHPVFLTA
    LIRLAGLTGDDRWLAKADALFKAVAPSVRTSFVGHAGILNALDLRLRIKDIVTAGPKRRDLYLAALKLPFIERVVMDLDK
    PEALPDNHPAKAQAAMAGDAAAFVCSGGACSLPVHSAEALESTASIA

    >gi|182678298|ref|YP_001832444.1| glutathione peroxidase [Beijerinckia indica subsp. indica ATCC 9039]
    MSKLYDITVKTIEGPSETIGEYKGNVILIVNTASACGLTPQYLALEKIYETYMDRGFVVLGFPCNDFGAQEPGTELEIQR
    FCEAKFNVQFPMFAKISVKPGSRHPLYEELIARQPKARTNPGAAPKEGSDISWNFEKFLVSRDGEVIDRFAPQVTPDSPL
    VIEAVEKALGPTA

    >gi|182678313|ref|YP_001832459.1| rhodanese domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MAGPAPKVVENVSIDELKKGLGDHSIILVDVREPNEYAEGHIPGATLNALQKFDVSALPHAGPGQRVVLACRAGGRSLTA
    LGLAQAAGRDDIKAHYPGGFQAWAQAGETVEK

    >gi|182678316|ref|YP_001832462.1| alkylhydroperoxidase [Beijerinckia indica subsp. indica ATCC 9039]
    MTQRLDYTKIASDGVKALGGVYAYVAHSGLSKALIDLVYLRVSHINGCAYCIDLHSRDLLKDGLGIEKLVLVPVWQEAKE
    LFSDEEQAALRWAEVVTLVAETQVPDEEFDSAARHFNEKQLVDLTIAIGLMNAYNRLAISFRAIPQAVKSR

    >gi|182678484|ref|YP_001832630.1| dihydrolipoamide dehydrogenase [Beijerinckia indica subsp. indica ATCC 9039]
    MAAAYDVLIIGGGPGGYVTAIRSAQLGLKTAVVEREHLGGICLNWGCIPTKALLRSAEIYHYLQHPKDYGLTIEGKIGFD
    PAAVVKRSRGVSAQLNGGVGFLLKKNKVDVIWGEATITKVGEVTVAATKKTIVQPQNPIPKGVLGEGTYSAKNIIVATGA
    RPRVLPGLEPDGKTIWTYFEAMVPESFPKSLIVMGSGAIGIEFASFYHTMGAEVTVVEVLPQIMPVEDAEIAGLARKQFE
    KQGIKILTGTKVTKIEKNAQGLTATLEDSKGAISTLSAEKMISAVGVVGNSENLGLEKLGVKIDRGIISVDGFGRTNVPG
    IFAIGDVAGPPMLAHKAEHEGVICVEAIKGLHPHPMDKSMIPGCTYCQPQVASVGLTEAKAKEAGYTVKVGRFPFVGNGK
    AIALGEPDGLIKTIFDAKTGKLLGAHMVGAEVTELIQGFVVAMNLETTEEELMHTVFPHPTLSEMMHESVLDAYGRVIHM


    >gi|182678617|ref|YP_001832763.1| methionine-R-sulfoxide reductase [Beijerinckia indica subsp. indica ATCC 9039]
    MIDAEEGVMTQDNSKSKITKSDAEWRAQLTPSQYEVTRRHGTEQAFTGPNWDQKKPGLYSCICCGAPLFQSETKFDSGTG
    WPSFYAPVQAGAVEEHADNSHFMHRTEVRCAKCEAHLGHVFPDGPQPTGLRY
    CMNGQSLKFEPTDK

    >gi|182678635|ref|YP_001832781.1| DSBA oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039]
    MFDMGSTIFTRHWIGLTFALSTLVGLIMSPCHGPSSFAISSAAAAEFSSAQKTEIQSIIKDYLIENPEILRDALNELELR
    DRAAAANARAAVVADMSGPLYTSQQQSVVGNPDGKISLIEFFDYN
    CGYCKRALGDIAQLIKDNPDLRVVLKDLPILSPGS
    IEAARVAGALRNQFKGEKFWAFHQKLLSSHGPVAKAQALAVAKDLGADMDKLEKDMASPDIVQGIAVTDRVAKELDINGT
    PSFVLGEEVVVGAVGRDELQSKITNIRKCGKTTCS

    >gi|182678807|ref|YP_001832953.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Beijerinckia indica subsp. indica ATCC 9039]
    MSKQSLSELFAELQAERQKTWEPEAYQRQANQRQTLVEDFAKRTYAAAGDIVAPLPLLDVTGGTIELDDLVANRPAVLIF
    FRHAG
    CPACNIALPYYQRELAPTLKTLGVPLVTVSPQVPERLGDIKAQHQFDFIVASDPNNDLARSLNIVFESDEPSKQA
    ALAKGYSLPEIIGTGTWELPTPAVIILDRGRVIRFIDISPDWVVRTEAETIISRLQEVIEKTAEPQLA

    >gi|182678810|ref|YP_001832956.1| redoxin domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MNKLQDVDWSRIPVPEDDGKADHLHQAMMPHVPLMVTDGRTIDLAALTGLTVVYAYPRTGRPDIPLPEEWDIIPGARGCT
    PQACAFRDHFAELRELNVDYLFGLSTQDTLYQQEAVERLHLPFPLLSDHELALTKALHLPTFEVDGITLLKRITFIIETG
    SIRQVFYPVFPPDQNVSDVISWLRSHRT

    >gi|182678906|ref|YP_001833052.1| peroxiredoxin [Beijerinckia indica subsp. indica ATCC 9039]
    MSETIREKSLEKPQDRRTAQPLLLGSQAPLFVARTTMGERALAHYRGRWLVLFSHPADFTPVCTSEFIAFAKAYQRFQAL
    DCDLLGLSVDSLFSHIAWVRSIKQRFGVEIPFPVIEDPSMAIASAYGMIHADAADSSTVRASFIIDPDGVIRLILWYPMS
    IGRSVEEILRVVEALQVSDSAAVSTPEGWHPGDPVIETPPLDVEAIGADNAALDHERDQELGTDWYYRLRKL

    >gi|182678960|ref|YP_001833106.1| OsmC family protein [Beijerinckia indica subsp. indica ATCC 9039]
    MTIVRKASAKWSGGLKDGKGAISTESGALDAYPYGFASRFEGQKGTNPEELLGAAHAGCFTMALSLILGEAKLVATEMET
    TAKVSLDQVEGGFAITKVHLTLTAKIPGADQATFTELANKAKAN
    CPLSKVIKADISLEATLLA

    >gi|182679041|ref|YP_001833187.1| protein of unknown function DUF395 YeeE/YedE [Beijerinckia indica subsp. indica ATCC 9039]
    MSSYWYSLAGGLLIGLSAALLLLLNGRIAGISGIIGRLLGGDHLPANGAFLIGLILGPLVFKVFFGHAPDVTITEPWPLL
    IVAGLLVGFGTRLGSG
    CTSGHGVLGLARLSPRSFAAVVTFLIAGILTVFLLRKFGL

    >gi|182679073|ref|YP_001833219.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
    MPSLKVTDATFARAVIDAGLPVFVDFWADWCGPCHAVAPLLEDLADELQGRVIVAKLNIDENPDTTALQDIHSVPTFKIF
    KNGELAAQDIGAYTKDALRAWILETIA

    >gi|182679081|ref|YP_001833227.1| AraC family transcriptional regulator [Beijerinckia indica subsp. indica ATCC 9039]
    MRQHALPRGTQPAVPIEDDPRWIAVVDRDSRFDGTFVYSVKTTGIYCRPSCPSRLAKPGNIRFHAHCAAAEKAGFRPCLR
    CRPHEASLAHDHADLIVAACRRIETAQKQLSLDQLAKAAGLSPFHFHRLFKSITGLSPKAYGAAHRMNKIHKALSAGEES
    VTATIYASGYQSSSRFYATSKEMLGMTATAFREGGNLAEIRFALGETSLGSLLVACSAQGVCAIFLGDDPEALVHELQGR
    FPKAHLIGGDEGFEALVAKVVGFVETPARGLDLPLDIRGTAFQHKVWQALCEVPFGETASYTDIARRIGAPKAVRAVAQA
    CAANKIAVAIP
    CHRILRTDGSLSGYRWGVERKRALLLKEGATKNSN

    >gi|182679101|ref|YP_001833247.1| arsenate reductase and related [Beijerinckia indica subsp. indica ATCC 9039]
    MSAPIDIIIYHNPDCGTSRNTLAMIRNAGIEPHVIEYLKTPPSRPLLEQLIARMGVPVRAVIREKDTLCAIDRCHDGASD
    PDQSSDRRLAARRQTLPTFRNRSRSLAQAAARSFHKGGWAVVDDDGQRVI

    >gi|182679139|ref|YP_001833285.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
    MATVKVTDATFKNDVVDAKAPVVVDFWAEWCGPCKMIGPALEEIADELADKVKIVKLNVDENPGVSGAYGIRTIPTLLLF
    KDGKIANTKIGAAPKGELKKWISDAL

    >gi|182679301|ref|YP_001833447.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039]
    MGEAIVTDVVIVGAGPAGLFAVFELGLLDIKSHLIDILAKPGGQCAELYPEKPIYDIPGYPRVNGQELVDNLLAQIEPFH
    PTFHFGEMVERLEVLGTPEAPSFRVHTSGGEIFESKVVIVAAGGGSFQPKKPPIEGIEAFERKSVFYAVRKMEDFRDKHV
    VIVGGGDSALDWTLNLHPIAKRITLVHRRDDFRAAPHSVNSMRELVAAGHMDLRLGQIVSLRGEAGELSAVVLKGSDGEA
    EIACERLVPFFGLTMKLGPIADWGLNLHENLIPVDTEKFETNVSGIFAIGDINTYPGKLKLILSGFHEGALAAQKVHRYV
    YPDKRLSFQYTTSSSSLQKKLGVN

    >gi|182679382|ref|YP_001833528.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Beijerinckia indica subsp. indica ATCC 9039]
    MAAIGEKVPAFSVVGVKPGFEKHEENGVSAFEELTEASFPGKWKVIFFYPKDFTFVCPTEIAEFARLHKEFEDRGAVVLG
    GSTDNEFVKLAWRRDHKDLAKLPIWSFADTNGSLTDGLGVRSPAGVAYRYTFIVDPDNVIQHIYANNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGDTLKVA

    >gi|182679418|ref|YP_001833564.1| putative selenoprotein [Beijerinckia indica subsp. indica ATCC 9039]
    MADDAPRVSIRYCTQCNWLLRAAWMAQELLNTFGQTLGEVALIPDTGGWFEIKVNETLIWERARDGGFPGPKELKQRVRD
    VIEPGRDLGHIDR

    >gi|182679496|ref|YP_001833642.1| rhodanese domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MSIREINRAALQTWLSEGTASRQELALLDVRPEEAFGKGHPFFGTNLPLNRLEQDVSLFVPRKAVRLVLVDAGDGDSEKA
    AAILDKLGYSDINILKGGVPAWTEESLNGQPTFDIPGIVFSESVRDAQKTPSISATELNALYASGADVVVLDTRTIEEFA
    AFHVPRARSLPGAEILHRFLDYVPSPDTLVVIS
    CAGLPRAIIGAQTLIDADVPNRVVLLEEGTTGWKQAGFELESGLQDQ
    FGPVTPRAAAFGEERARVLTQLTDVEDISPEEVAEWLADDSRTTYVLDVRLPQDFARGHWTGSVSAQGGQLLAVSHRSVA
    VRDARLILIDEHGTQAVTTAYWLRRRGWEVRIFSGALAELRQSGENSLDAQTVQPLETIS

    >gi|182679594|ref|YP_001833740.1| heavy metal translocating P-type ATPase [Beijerinckia indica subsp. indica ATCC 9039]
    MNLATTESSPPLSLAIKGMHCASCVGRVEKAILLVPGVKTASVNLATERAEIRFDATPNLAPVVEAIKTAGYEPVMETAE
    FTVDKLN
    CASCVNRAEKAFMSVPGVLEAHVNLATKTAVATFATGTTDVAELEEAVTKAGYPTHERRDEGESENLSGSENG
    AQHHKHEDPSETQVLFRDFTIAGVLTLPVFILEMGSHLSHAFAHGIMDTIGLFPSHVLSFALTSLVLAWPGRRFFVQGVP
    SLLHGAPDMNSLVVLGTSAAFFYSTLVTFLPNLFPEASRQVYFESAAIIVTLILLGRALEAQARGKTGAAIQHLLGLKAH
    QARVLRHGEPVDVEIGRIKTGDIVVVRPGEKIPLDGTVIEGTSFVNEAMLTGEAAPVLKASDAEVVGGTVNLDGGFQFRV
    TRTGKDTVLAQIIRMVEQAQGAKLPIQALADRITAWFVPAVLGLAVLTFLFWFWLGPQPALSFALIQTVSVLIIACPCAM
    GLATPVSVMVGTGRAAELGILFRKGAALQSLAEVDTFAFDKTGTLTKGQPVLTDFVVLPSFSRDTILSLIASVETRSEHP
    IGKAIVQAAKQDGLATKPVEHFSAEAGFGIEAKIEGQRVTIGSDRLMAKQGIDVSPLAKEAAALANEAKSPLYGAIDGKL
    AILLAVADPIAPAAAEAIAALHKEQRQTVMVTGDRRETAEAIAKSVKIDRAIAETLPQGKRDVVEELKRGGHKVAFIGDG
    INDAPALAAADVGLAIGSGTDVAIESADVVLIRRQLTTVADALAISQATMRNIKQNLFWAFAYNVVLIPVAAGVFYPLFG
    LLLSPMLAAGAMAFSSVFVVTNALRLRQFIPAAQTATPAEGASHTGVAPLTAQAKGL

    >gi|182679606|ref|YP_001833752.1| rhodanese domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MTTIDARSIRHALLTRNEITIIDPRDEHSFAQGHPLFAAQIPLERIAIEAPTRLPRLDALLVIYDQGEGLAEKAASVFKG
    LGYSDVRLLEGGLQAWRDAGYELFQDVNSASKAFGELVEQRRHTPSLPAQEVKALIDEGADVVVLDARRFDEYRTMSIPT
    GTSVPGAELVLRAGALAPDPQTTIIVN
    CAGRTRSIIGTQSLINAGLPNPVRALRNGTIGWTLAGQSLETGQQRRAPAVEG
    DAATQARSRTHEVAYRAGVKWIDSTDLAALAEEPGRTLYRFDVRLPEDYALGHIPGFLNAQGGQLVQETDHFAPVRGARI
    VLADDLGARAEMTASWLAQMGWEVYVLSPGYSGELEQGQGVAPPPRGPEGRYKRPYEGTDNKTEAMQAYLDWEFGLIAQL
    QRDATHGFFVI

    >gi|182679609|ref|YP_001833755.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Beijerinckia indica subsp. indica ATCC 9039]
    MTVREIDYLLLGGGGAAASAAATLRLEGATGSIMILSADDLLPYYRPSLSKQFLLGQSSEKQILLHPRNFYEEKNIEFVL
    GRAVTAVDCAQGLVRTAAGDEIRYRQLLIATGLRPKRLALPGTDLPGVHYLRSKTE
    CVITREQIASGAKHAVVLGASFLG
    MEIAMTLLELGLHVTLIECHDLVLPHIESEKISNHFKLHAEERGAHILLRDTITAIHGTSKIQEVETQSGVRLPCDLLMV
    SIGGEPATDFLAGSGIALDDGLVIVDDQLRTNVQNVYAAGDVTSFHDPVFAQRRHIEHWDSAIKQGRLAARNMLGRRMRY
    DEVSYFFCDIGEISFSMLGAPEEANERIARGSLTTKSMALFYLKDDVVRALFSVGRPTEETRNVEGLIRYRVNLHDIKDR
    LHDPEAPLDQIPTQTVLVLQGGGALGAFECGVVKALEEERIFPDIVAGISIGALNGAIVASNPRHATEALESFWKDLRVT
    SAFMLDGKTTNAATSLGILMFGVPNFFRPRWLPSFSNPLPLPTDWTSFYDVAPMRKLITKYVDFSALKTSPVRLLVGAVN
    VVTAELEVFDSYVDDMTPDHVLASGSLPPGFPWTEINGQAYWDGGVVSNSPLDIVMERCGPDGKRVYIVDLFSGQRPLPT
    NLVEVIARRDEIIYAERVRNDIRMRELIDSYRQLVNNILDLVDQQAQAKIKQRPLYIELMGDGATMDITRFVRAGRKGEP
    SSRDYDFTDVSIRTNQAEGYALVKNQLEEAKRPLDKNHAEIGT

    >gi|182679627|ref|YP_001833773.1| iron-sulfur cluster assembly accessory protein [Beijerinckia indica subsp. indica ATCC 9039]
    MSEVISEAATETPVILTENAAKRVVEIMKTEAPGSVLRVGVDGGGCSGFTYTYNVVTEREPDDLVLERDGATVLIDQISL
    EYLRGCQIDFIDDLMGRMFKISNPSATASCGCGSSFAV

    >gi|182679699|ref|YP_001833845.1| alkylhydroperoxidase [Beijerinckia indica subsp. indica ATCC 9039]
    MIQRLNYAQQSPELFKKLSDLSVALKDSAIEQKIHDLVQIRASQINGCAFCLDMHVKEAKIHGESELRLYHIAIWRESNL
    FIPRERAALAWTEAVTKLPERGIPDELYERVRGQLSEKEISDLTFSIMIINSWNRASVAFKAVPGSADKLYGLDKAGLA

    >gi|182679704|ref|YP_001833850.1| thioredoxin [Beijerinckia indica subsp. indica ATCC 9039]
    MAGHSGQDAASASLTGGQNTSSTVTDTTTATFGQDVITASAQQPVLVDFWAPWCEPCKQLTPVLEKVAKAAAGKIKIVKM
    NIDENPQIPARLGVRSIPAVIAFNRAQPVDGFMGALPESQVRGFVERLVGPLNEEENLLAEAEALLAAEDPVGAAELFSV
    LVKEDPGNFPAVAGLAKSFLAAGQIDSAKKILASLPASGERDVAILAAKAAIELAEQTAALGDTADLVRKIEADPTDHQA
    RFDYALLLNSNGERDAAAAALLDIFKRDRQWNEEGARKQLLQFFEAWGPTDPATIAARKKLSALLFS

    >gi|182679857|ref|YP_001834003.1| methylated-DNA--protein-cysteine methyltransferase [Beijerinckia indica subsp. indica ATCC 9039]
    MISPMAWTYLFETPWGLCALQWSDLGVVGVRLPSHEAPIDHDFRRANRHPTAEVVQWGDMLRSYFAGDTVNFRTVPLDQM
    GVSETKQAIYAALREVEYGQTTSYGALAIRAGHPGAARAVGTAMARNRWPIIVP
    CHRVLAKNGALGGFSAPGGVNTKRRL
    LELEGAVADSDKPLPPGLFDKT

    >gi|182679867|ref|YP_001834013.1| alkylhydroperoxidase [Beijerinckia indica subsp. indica ATCC 9039]
    MSMMDWNVYRQQVLSGVSDIGKLSPETVRGYVQLGSAGAKTNHLDAKTRELIALACAVTLRCDGCITVHSEQARKLGATR
    EEVAEALGVAIALNAGAALVYSTRTLDAFTAAGDI

    >gi|182680021|ref|YP_001834167.1| glutaredoxin-like protein [Beijerinckia indica subsp. indica ATCC 9039]
    MSAINDLIQSIVDKNDVVLFMKGTPNFPQCGFSGQLVQILGYLDVNYEHVNCLENDEIRQGIKDFSNWPTIPQLYVKGEF
    IGGCDIVREMFQSGELATHFSGKGIDVKQPTKA

    >gi|182680212|ref|YP_001834358.1| glutaredoxin 3 [Beijerinckia indica subsp. indica ATCC 9039]
    MSELPEITIYTTQTCPYCRRAKELLTKKNLPFTEISVDGDFEARERMTERANGRSTVPQIFFGDKHIGGCDDLYELHYDG
    KLDLLLADLARTPTD

    >gi|182680215|ref|YP_001834361.1| glutathione S-transferase domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MVTLFHHPLCPHSRFVRLLLGEYGIEPRLIEEKTFERRPDFLALNPAGTTPVLIEADYVVPGAEVIAEYLDETRGLGLGR
    HRLLPDDPIERIEVRRLYDWFARKFFQEVSDWLITEKVTKRYMTRAQGGGGPDMEVVRVARSNIRYHLRYIGYLAGRRNW
    LAGDRMTHADLAAAAQISCIDFLGDVPWEEDEAAKLWYARVKSRPSFRSLLNDRLPGLAPAAVYADLDF

    >gi|182680240|ref|YP_001834386.1| peroxidase [Beijerinckia indica subsp. indica ATCC 9039]
    MSLQLNDTAPDFAQDSTEGRLHFYDWAGSSWVVLFSHPKDFTPVCTTELGIVAKLKSEFDKRNVKVIGLSVDPADSHASW
    SKDIEETQGQTLNFPLIADNDRTVSDLYGMIHPNASDTFTVRSVFVIDPNHKVRLTLTYPASTGRNFDELLRVIDSLQLT
    DKYKVATPVNWKQGEDVIIVPSVTDEQAKDLFPGGWTEQKPYLRTVKQPPLNA

    >gi|182680299|ref|YP_001834445.1| arsenate reductase [Beijerinckia indica subsp. indica ATCC 9039]
    MDYVIFHNPSCGTSRKVLAALREAGIELEIRLYLKSPPSPAELADLLARMDMTPRALLRRKEKVYAELGLDDKSLSDATL
    IAAMSAHPILIERPIVVTPKQAVLCRPPEKVEALLP

    >gi|182680507|ref|YP_001834653.1| dihydrolipoamide dehydrogenase [Beijerinckia indica subsp. indica ATCC 9039]
    MSSGMSYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKRKTFGGTCLNIGCIPSKALLYASEKFEEAAHELASFGVVVGKP
    TLDLPAMMKHKDDTVGANVNGVAYLFKKNKIDSFIGLGTITAPGKVQVKAEDGSTQDIETKNIVIATGSEVTPLPGVTID
    EQVVVSSTGALALPAVPQNLVVVGAGVIGLELGSVWSRLGAKVTVVEFLDRILPGMDGEVAKQAQRIFEKQGFTFKLGHK
    VLGVEQSGGSAKVTIEPAAGGEKIVLEVDKVLVSIGRRPVTDGLGLDQVGVTLDRGRVVIDDHFATNVPGIYAIGDVVRG
    PMLAHKAEDEGIAVAEILAGQHGHVNYNVIPGVVYTSPEIAAVGQTEEDLKAKGITYNVGKFPFTANGRARAMRQTNGFV
    KILADAKTDQVLGVHIIGPVAGELIGEACVLMEFGGSAEDLARTCHAHPTLSEAVKEAALGVDKRSIHI

    >gi|182680512|ref|YP_001834658.1| redoxin domain-containing protein [Beijerinckia indica subsp. indica ATCC 9039]
    MTENLEPAALKTRRRRYALPLMLLCLLALGAISLYEIRSPGGKKAVENIADEQACLASRKAAERIKPLIHGEVAALILSE
    APKPVSKISFHRPDGSDASLEDFAGKTLLLNLWATW
    CVPCRQEMPALDRLQAQLGSPNFEVVAVNIDTARLDKPNAFLDE
    IGVKSLTRYADSKAEIFQTLRQAGKVLGLPTTMLVGKDGCEIATMAGPAQWDSAEAQALIKAVQEF

    >gi|182680529|ref|YP_001834675.1| UBA/THIF-type NAD/FAD binding protein [Beijerinckia indica subsp. indica ATCC 9039]
    MVAVLSPEEIERYGRHILLRDIGGQGQQKLKAARVLVIGAGGLGSPLIQYLAAAGLGEIGVVDDDAVSLSNLQRQILHGT
    PDLGRPKVESAQEAVRRLNPHVVLTPFPTRLNGTNARGLIEAYDIVADGSDNFATRYLASDLCFHAKRPLVTGAVGAFDG
    SLTTLRPFETGPDGHPNPTYRCLFPEPPPDGTVPT
    CEEAGVLGALTGMLGAMMALEVIREIVGFGEGLVGRLLLVDALHL
    RFETLNYRWDPSNPLNGEPRAA

    >gi|182679243|ref|YP_001833389.1| molybdenum ABC transporter, periplasmic molybdate-binding protein [Beijerinckia indica subsp. indica ATCC 9039]
    MTKITRRTWGALGLLLTFTLALPQWSLAQAPAPAPTAGTGPVIFAAASMKTALDGVAAAWQAQTGKKPAISYASSAVLAK
    QIEQGAPADIFISADVEWMDYLDKAKLLKPGTRRNLLGNELVLIEPANDNVALKITSGFDLAKATGDSKIAVCTISS
    CPG
    GIYAKQAFENLKVWSEVEPKLAQADNIRNALALVSRGEAKFGVVYATDAKAEPKVKVVDTFPSASHNPIVYPIALLNSST
    NPDAQAFAGFLTSQAATKILTDQGFSILQK