Acidithiobacillus ferrooxidans ATCC 53993 uid58613

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|198282194|ref|YP_002218515.1| Rhodanese domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MFKRLANAAIPFALVGMLFGLSVSVASADDSGNQAAQQVLNARMEKFFADQKPFPYGTYQYTDRSLLLAISKDPSKYALI
    DIRTPTYHDFFCGVHSNKHVCTGRGWQRIYGYAQGHVPGAQNIPYLNLPAAIKSDSIPKNKTVILM
    CPTGQLSNQTAGVL
    RMLGYDAYALRGGVNGWKKAGYPIVIGKEPGTMAQACHPWQTCWRQFQYDNPQAH

    >gi|198282196|ref|YP_002218517.1| Redoxin domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MSKTVWPMAKVAIIAMIGAFLLWISLIKPMLHKSDVATATIPLVNGKTLDVTALRGKVVVLNFWSPDCPPCIQELPDLER
    LYQTYRAQGLVVVGIATPGSSRSRSLAAAAMAHVTYPLSVDQNGTLTRAVGGIMVTPTQVIIDREGRVIDKYQGVVSGEE
    PMDEILRALQQK

    >gi|198282202|ref|YP_002218523.1| protein of unknown function DUF395 YeeE/YedE [Acidithiobacillus ferrooxidans ATCC 53993]
    METIVWGFMFGAILQYARLNRFNTIAGMAVLQNLAVAKTMAFTVGLGMLLLQSEILLGWADYHVKPLILVGVVVGGLLFG
    VGMAVLGYCPGTVAISLGQGNLDALVGIIGGLCGALVFAVVYPSLNPLLGPNLGALSVRSLLPDDILFWSVTSAVAILFM
    GIALYLQKLQHHDWRWLHAAVGLALLNCVLTLPFVAGHPMGASTAFPYAAMTITELGAESYQAAIAAPGAWELWFLTGAF
    LAGLVFALLHRSFRISSVPELWVRYHGPKPAKRFFWAFVGGFLLLFGARMAGG
    CTSGHVISGGMQLAISSLVFAVVVFAA
    FLTTGHYFYRIRQAVPIPPSPRIVEVNEMEAR

    >gi|198282308|ref|YP_002218629.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MSQKIFLRITGMTCAHCAHSVEKALLGIHGIDSAQVSLATNQAEVFLQSSIPTEALLAAVTQAGYGAKVEQDSLQVQARS
    TQEPGQPHIAIIGSGGAAMAAALKAVERGARVTLIERGTIGGT
    CVKVGCVPSKILIRAAHIAHLRRASPFDAGIAAQEPV
    IRRDRLLAQQQGRVDELRYAKYEGILAQTPAISVLRGEATFQNAQTLSVVLADGGVHELRFDRCLIATGASPAIPPLPGL
    ADTPYWTSTEALASETIPERLVVIGASVVAVELAQAFARLGSKVTILARSVLLSHEDPAIGEAITSAFRAEGIHVLEHTQ
    PNRADYNDGQFLLTTGNGHLRADRLLIATGRAPNTHSLNLAAVGVEVNAHGAIVIDKTMRTSAPYIRDLKRRLDGGQRKL
    LANVRNTTGSYIIQHEEVAQLQLGEQVVHTARFSAFYTDRQAPRRYVAHGEPRFIAFLTALATSFFQTARNGP

    >gi|198282309|ref|YP_002218630.1| Heavy metal transport/detoxification protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MSQKIFLRITGMTCEHCAHSVEKALLGIHGVDSAQVSLATNQAEVFLQSSIPTEALLAAVTQAGYGAKVERDYLQVQARS
    TQEPGQPHIAIIGSGGAAMAAALKAVERGARVTLIERGTIGGT
    CVNVGCVPSKILIRAAHIAHLRRASPFDAGIAAQEPI
    IRRDRLLAQQQGRVDELRYAKYEGILAQTPAISLLRGEATFQNAQTLSVVLADGGVHELRFDRCLIAV

    >gi|198282335|ref|YP_002218656.1| Glutaredoxin 2-like protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MLTLIHFDFCPFCQRGRLALGYKNIEFAELPARFYGPEHFRNISGFERLPVIIYPDGDCQGESLDIIAELDRRFPATPPL
    HLGAIAAADLEAAMAWRARISGMLFRLIAPTLPQYPGLGDDPRAMRYYRERMEGWLGDTLEGLQARRHLWYASMEADLHE
    ITDRVARHGFYTPVLSVADTLITGDLTGLRLLEGITLPPELNAYFARVEAAAGISLLPEPLLQGQNP

    >gi|198282351|ref|YP_002218672.1| Redoxin domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MAISRRLASALVLLAALGAAVAAYALTEQNAAPATPAVTFTTLDGRQIRLQGQQGKIVMVIFWATNCSICMGEMPDLIET
    YRQYQARGFELIAVAMAYDDPEQVRKFARSKGLPFPVVLDTSGSLARSFNDTKVVPTIFLIDKKGNLVSRTLGAIDFSKL
    HQYLNRS

    >gi|198282462|ref|YP_002218783.1| Rhodanese domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MTKSVINLAPQDAFHFLQKNPQAVLIDVRSEMEFLFVGHPKEALTIPWRDDPDWEINPDFLCRVRRATSLNRPVLLICRS
    GHRSLEAGQYLQANGFSAVYNVAHGFEGDLNDQHRRSSLNGWRFDGLPWEQI

    >gi|198282538|ref|YP_002218859.1| Glutathione S-transferase domain [Acidithiobacillus ferrooxidans ATCC 53993]
    MATPSSKKTLMTLYSSNDCVFAHRVRFVLEEKAMEYQIIDVDLGNRPEDLAELNPYNQVPTLVDRDLAIHESVLIMEYLD
    ERFPHPPLIPVDPISRAKVRLGLLRFDRDWFAPLFQPGYGAEQVKTAKEQIRSTLAGLNSIFSQQRYLFGDDLSVLDCAI
    APLLWRMPVLDISLPAAARATQNYMDRIFGMESFKRSLTPAEKAMR

    >gi|198282591|ref|YP_002218912.1| protein-disulfide reductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MERPTRRFLSPARLSGLIAVLVASAAAGAFVLVLWLQFARGYEPCSLCVYQRLANVAVLLIVVMGFFWAGAARRGLWMLA
    SVYALAGAGLAGWQWHLSAIASHAPEA
    CTAVDIFPSGGSFGPWGKEAASVFSGQGSCAAAGARTLAGWPVTHWSLVFFLT
    CAVLLWLAQWLSGRQDRR

    >gi|198282592|ref|YP_002218913.1| hypothetical protein Lferr_0452 [Acidithiobacillus ferrooxidans ATCC 53993]
    MTIVHAVQTLARSLAIGGVILTTSVGIAQGATAATDHDLDYWQALSHTRYIEEGSKGPILYDFLDPNCPYCHQTYVWLQN
    PIDGGQLRVRFVIVGFLSPSSKGKAAAILAAPKPLAALRRTEKGFAMTPNGPEGGIKPADAAVVANVLNQLQFNQSRLDG
    KESELFGMEGAAVPFLVYQRGKKIHYLLGPPDNAQWKDLLDAS

    >gi|198282607|ref|YP_002218928.1| Glutathione S-transferase domain [Acidithiobacillus ferrooxidans ATCC 53993]
    MPLELISFPLCPYVQRSVITLLHKQVGFTLTHIDLAHKPEWFLALSPLGKVPCLKIDEHTVLFDSQVINEYLDETIAPVL
    HPADPLERAQHRAWIAFGSEILGDQMQMMVAQGEERFTAASRQLFDKLERLDKAMGNGAFFAGDDFSLIDAALAPLFMRM
    EILHALRPLPRWESLGKLRRLTALLMELPEVAGSVTADFPDRLRNYISERGSLFLRTA

    >gi|198282673|ref|YP_002218994.1| hypothetical protein Lferr_0533 [Acidithiobacillus ferrooxidans ATCC 53993]
    MADKLLMVMVNTDPSNPQELGAPFFQATVAAAMDFEVEVVLTARAGELAKKGVAEKMFVMPGSPKSVYDFIKDAHEAGVK
    FFV
    CTPTLELWECTKEDLIPEIQDIVGGAYVIEQAMDDDVVTFTY

    >gi|198282676|ref|YP_002218997.1| glutathione-disulfide reductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MTQSYDLIVIGGGSGGIAMANRAARYGAVTALVAAGPLGGTCVNAGCVPKKIYWNAAHLAGQMKMAGEYGFDTIEPRFHW
    EHLKQQRDTYIGRLNDRYAQGLDGNGVSLIRGHARFSGAHRIHVGDSTLEAAHILIATGGHPVWPDIPGAELGITSDGFF
    ALESRPRCVAVVGAGYIAVELAGVLHALGSDVSLVMRRRHFLNDFDPMLRESLMDAMLRQGISLLAQREVRELEKRADGL
    CLHFHDGDCLGGLDAVIWAIGRRPNSADLGLEFANITADPQGFIPVDAFQNTDAPGVYAVGDVTAGPALTPVAIAAGRRL
    ADRIFGNQTERHLDTLVVPTVIFSHPPIATVGLSEAVAKEQYGEEAVKVYQTTFTPMFRAFAAEPEKTAMKLVTVGREEK
    VVGLHAIGDGVDEMLQGFAVALRMGATKQDLDDTIAIHPTSAEEFVTMR

    >gi|198282677|ref|YP_002218998.1| glutaredoxin-family domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MKLTSIEGQGVPQAVFRTRDDNQWRDVSTDELFQGKTVIVFSLPGAYTPTCSSSHLPRYNELAPTFRENGVDDILCMSVN
    DAFVMDAWAKELAVENIHLIPDGNGEFTEGMGMLVDKSELGFGKRSWRYSMLVKNGIIEKMFIEPDKPGDPFEVSDADTM
    LHYINPEARDPEFVTIFTREG
    CPHCARAKAMLKEHGIAFEEIKTGMGTGVSSRTIRAVSGRSTVPQIFIGGRHIGGADDL
    EKYFHGK

    >gi|198282685|ref|YP_002219006.1| thioredoxin reductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MSDPKSVIDEKHCRLLILGSGPGGYTAAIYAARANLSPILVQGMEPGGQLMTTTEVDNWPGAADGIMGPELMQGLEKQAR
    RFDTEILFDHIHTADLRQRPFRLSGDQHCYTCDALILATGASAKYLGLPSEDKFRGKGVSA
    CATCDGFFYRGQAVAVVGG
    GNTAVEEALYLSNIAKHVTVIHRRNRFRAEKILQDKLMAKENVTVIWDHSVAEVLGDASGVTGLRIQHVENGSTQDLALM
    GVFIAIGHQPNTGIFKGQLKMDEGGYLVTRGGRDGMATATSIEGVFAAGDVQDYVYRQAVTSAGTGCMAALDAERWLEQQ
    QEG

    >gi|198282814|ref|YP_002219135.1| protein of unknown function UPF0061 [Acidithiobacillus ferrooxidans ATCC 53993]
    MDKALLHFDNSYARDLEGFYAPWQAATAPAPRLLLLNQALAEELGLDSATLDDELGAAIFSGNQVPEGALPLAQAYAGHQ
    FGHFSPQLGDGRALLLGELIDRHGRRRDMQLKGSGRTPFSRGGDGKAALGPVLREYVIGEAMHALGIPTTRALAAVTTGE
    TVRRETWLPGAILTRIAASHIRVGTFQFFAARNENVRVKQLADYTIARHYPPLKGADNPYLELFAAVSAAQAALIARWML
    VGFIHGVMNTDNMSIAGETIDYGPCAFMDNYDPETVFSSIDAHGRYAYAHQPLIAQWNLTRFAETLIDLVHPDPDEAARL
    LTEQLNEFPKLYTRHWLDGMRAKMGLATAEDGDLALAQALLSAMEGQNADFTQVFRGLSAAVRGDPAQVRAHFVNQAPFD
    LWLAQWQARLAHESATAEARAEAMDQVNPLYIPRNHKVEEALAAATLNQDLTPFKALLAVLERPFAERPGLESYTQPAPE
    DFGPFKTF
    CGT

    >gi|198282824|ref|YP_002219145.1| Rhodanese domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MGKSLADFIRAARRQIREIDCDTLEDWLRSRDDVLVVDVREASAFLDGHLPGAIHVPRGYLEALADPDYGHCHPELAVAR
    DRVVVLY
    CDSGTRSALAAVTLQEMGFTEVYNLGGGINVWDAEDKPVVS

    >gi|198282838|ref|YP_002219159.1| cytochrome c biogenesis protein transmembrane region [Acidithiobacillus ferrooxidans ATCC 53993]
    MARNDVGMRAGNGRRAGWAMGVQLWSGICGVLLLSWLSLGCAGTFLTPDQAFHFEARLSGRHQLQLHWDVAQGYHLYRDR
    IKFSVTPSNVLLGHYTLPAGVELNDPVFGKTRVLEGKNTLTVPFTVQGTAPAFIELKSTYQGCANAGVCYPEQVKTIKLA
    LTQQAVPPPAAVPVVPPPGTAVPAAAVSPVNDAGALAGALRDSFWLTLGLFFISGLGLAFTPCIFPMIPILSALIVGKEA
    GRGPQRSRALGLSVAYVLGMSLTYSIAGVLAAVSGAYMQAAFQSPWVLGAFAFVFVLLALSMFDFYELQMPSGIQTRLAG
    MGRGGHLFSTFVMGVLSALIIGPCVAAPLAGGLLFISQTGDVFLGGLSLFALSLGMGVPLLIIGTSAGHFLPRVGAWMNA
    VKAVFGVVLLGVAIWLLTRVLPGPVSLALWAALAVISAIYLGALDAIPAGASGWRRFWKGLGVLMLVYGLVMGVGALGGA
    SDPLQPLTGYTAAVPPENRAEALHFTTVKTPEALQSALVQARGRPVLVDYWASW
    CVECLRMDKVTFADPQVVAALRKRLL
    IRVDVTQDDAASRALLKRYNLVGPPAFIAVAADGRTTAQQEGYLGPEAFMGWLHQS

    >gi|198282938|ref|YP_002219259.1| UBA/THIF-type NAD/FAD binding protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MTDTLDDAALLRYARQILLPEIDIAGQQALAAGRVLIIGMGGLGCPAAQYLAAAGVGNLTVCDGDQVDLSNLQRQILYGE
    ADLGRPKALAARDRLRAMNQQIRVSAWVESAQPESLAAALDTHDVVLDCTDNFGSRHAINRACRNAGKPLVSAAAIRWEG
    QLAVFDFRVSESACYACLYPDGVEDTEDT
    CSRSGVLGPLLGVLGSMQAAEAIRLLCTGHSPLAGQLLLVDAQSWQWRQIA
    LRRDPACGVCA

    >gi|198282942|ref|YP_002219263.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
    MSDAILYVSDDSFETDVLKSSKPVLVDFWAEWCGPCKMIAPILEEIADEYADRLRVAKFNIDENPNTPPQYGIRGIPTLL
    LFKAGKLEATKVGALSKAQLTAFLDSQL

    >gi|198282960|ref|YP_002219281.1| iron-sulfur cluster assembly protein IscA [Acidithiobacillus ferrooxidans ATCC 53993]
    MALTLSESAARQVRKSIAKRGKGLGIRIGVKTSGCSGLSYVMEFVDVPNPEDLVFPHDDVNLFVDPKSLIYLDGTELDFT
    REGLNEGFRFNNPNVKDACGCGESFTT

    >gi|198283202|ref|YP_002219523.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MSTDNYDVTIIGSGPGGYRAAVLAALRGKRTAIIERKTWGGTCLNRGCVPKKDWHETAKWIEQSRHFQKRGVIGPVLRGN
    MAQAWQHQHDVVETVRGSYLDYLKRLGIHLYDGTGSFLDARRIAVEGVGGLVEIHTETSIIATGSAPSLPRGIVPAAGKV
    LTSDMLYDNGVPHGDRVILVGGGVIGTEFAYIFTQLGKQVEWLVHSTPLAHTRYSPQARDILHAALAGLGIHPQSGFRIH
    RMETTTEGVTVFDDQGKPIHGDWVLLATGRHAYTEGLGLENTRITLDDHGFVQTDAALETGEPGIYAIGDAVGPIMNANQ
    ALNDARIVIHNLLSTEKQERDPLWVPELVYSAVELARIGMDDEAAEDAGFEPAVGFAAFETSPRALGQDDGVGFVRLLAD
    MDSGELLGGEIVGRDAGELIHLLANGGDHDGMLRRIVETRTNHPSRAEELVNATETLAARWGLEEQIFGPSD

    >gi|198283227|ref|YP_002219548.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidithiobacillus ferrooxidans ATCC 53993]
    MAVLVGKAAPDFVAPAVMPDNSINEKFQFSQHIKGKYAVLFFYPLDFTFVCPSEILAFNHRLNEFKSRNTEVIACSVDSH
    FTHLAWKNTPEEKGGIGHIQLPMVADLSKSIARNYDVLLNDEVALRGSFLIDREGIVRHEVVNDLPLGRNIDEMIRMVDA
    LQFSEEHGEVCPAQWQKGKAGMKPTSEGVADFLAHHGKEL

    >gi|198283308|ref|YP_002219629.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidithiobacillus ferrooxidans ATCC 53993]
    MSSETITVGQPAPRFHAAAYGKAASISLDDLRGKVVVLYFYPKDDTPGCTTEGQEFTALYPEFQAAGAEILGVSRDTLAS
    HEKFSCKFNFPFPLLADTDAALCNAFDVLKKKNNYGKVSIGVERSTFVIDREGKIAYIGRKVKAAGHAAAILQIVKQLP

    >gi|198283344|ref|YP_002219665.1| Rhodanese domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MNTRSFHRIDVHKARELLQRPDTVLLDCRHPSDFRAGHIAGASPLGDYNADDHVLNIAKHRPVLIYCYHGNASQMRAQLF
    ADFGFAEVYSLDGGYEAWRKVHTPANSQLTEALQCWLMAQEFPAADIHARTRDGVTPLMRAAGEGDPARVAELLAAGADP
    HQRNNDGNQALWFACVSENLDTLDLLVAVGAHLNHQNDNGATCLMYAASAGKTAVVERLLAFGADRSLLSLDDFTALDMA
    ANLECLNLLRETPRRIKAVT

    >gi|198283351|ref|YP_002219672.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MLILTEKAIDVVKNLLAENPEASGLRVAVTGGGCSGYQYGMGLEAEAGAEDTVVAIEGVPVYVDNASATLLNGVVIDYVD
    ELSGSGFRFENPNATGTCGCGSSFTTGDEASASSASSCGHRS

    >gi|198283367|ref|YP_002219688.1| ADP-ribosyl-(dinitrogen reductase) hydrolase [Acidithiobacillus ferrooxidans ATCC 53993]
    MGYDLRERALGAYLGLAIGDALGATVEFMSPTEIREEYGVHRNMTGGGWLHLRPGQVTDDTQMCLVLGRSILADEQWSVT
    RFAEGMVQWLRSHPVDVGNTCRRGIRRFMLNGSTAAEPAEWDAGNGACVRNLPAVLATLSAPATFRRISVEQAHLTHHHP
    LSDVATLTLGEMLRCALRGEGVSSVRRLADALVARYPEFAFKEIPQAPTPYIVDTVRAVLYALLHTDNFKDCLIAVVNQG
    GDADTTGALAGMLAGGLYGTYGLPGTWLQRLDPAVQKEIAAQVDQLLIRGERTDHEQLPASMPPRIVFYEKPG
    CANNARQ
    IALLRAAGCVVEVHDLLQTAWTAETLRPYFSDRPVAEWFNPASPRVKSGEIVPEAFTEAGALAAMLLDPLLIRRPLMEAG
    DAKIAGFSEDQLRRWTSASLDVYAEGTGAATDSCRRSVPCPSVRQASNLTKTPAASSHANAS

    >gi|198283371|ref|YP_002219692.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MELTFTPKAERFIQRMITFGGGNASSAFRLAVKPGGCSGLSYDFRIVDAAEPGDVAITSNGIPVLLEQKSVPFLNGVIVD
    CEDSLMNTGLVFTNPNAAASCGCGTSFTPKE

    >gi|198283393|ref|YP_002219714.1| methylated-DNA/protein-cysteine methyltransferase [Acidithiobacillus ferrooxidans ATCC 53993]
    MLNQALRWQLDRVTTPLGVMLLVSDAQNTLRALDWADSEARMLDRLRLLYGSDGVTLTSGTAPQPVRNGLEAYWAGDLNA
    VSAIPVETAGTAFQQAAWAWLRSIPPGETRSYQEQARGMERASAVRAVGRANGANPIGIVIP
    CHRVIGANGTLTGYAGGI
    ERKRWLLRHEGGDF

    >gi|198283596|ref|YP_002219917.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MAETVTDILIVGGGPAGMMTGITAAQFSPHKKVLVIRPETDAVIPCGIPYIFGTLGGTDEDMAGRAPLLAAGGQLQIGTV
    QQIDRVAHTATLSDGNVMHWERLVLATGAENFIPPIPGTGLEGVFSIRKDYDYLDTLFSTLIPQIKKLAIIGGGFIGVEF
    ADEIRKRGIEVHIVEMLPHLMQAAFDPDACAAVEKQLRAHGVHIHTGARVEALLPDSGGRRVGQIQIAGQEALTVDAVLI
    AIGTRPQVALARDMGLTLSRSGGIWVDAFQHSREDPNIFAVGDCAHKQDFFTRKANHAMIASQAAAEGRIAGMNLYGLRQ
    LRYNAGSVSIYASEIDGLAFGVAGLTERQAELEGFPILVGETRLPDHHPASMPNTTEIYCRIIFAADSLQILGGQILGGA
    TTGELVNTIGLAIQMHASAPDLASMQFGSQPRLTPSLHPLVAAAGDALRRHYEPLHPCVTGDPHA

    >gi|198283605|ref|YP_002219926.1| alkylhydroperoxidase like protein, AhpD family [Acidithiobacillus ferrooxidans ATCC 53993]
    MSANDRVNEIAQLTERLKDKYPAEINAFLGFMGKTEGNPALGKAQKELINVALSVAAQCEWCIALHVKGAVTAGATRDEI
    MSAGFLAVLMHGGPALMYLVRLTEAVDAFLPEESHG

    >gi|198283646|ref|YP_002219967.1| Heavy metal transport/detoxification protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MSDIRLKITGMTCGHCVRAVTKALEGIPGVEKADVTLEPGEAVVHGLADTATLIAVIREEGYEAEECKKSQSGS

    >gi|198283655|ref|YP_002219976.1| hypothetical protein Lferr_1547 [Acidithiobacillus ferrooxidans ATCC 53993]
    MEKKSIALAVGLFIIGGLTGAVVERFAVMPGTGSGVSLGTAASLLESVTHGEAKAEKVFPGPGGLTGIEVTLQGHPTVAF
    ATADGRYLVAGPVLNKQGEDEAHTAMVKLGLIPKPASAGALAAKAAGADSFVLGTGGPEITAFVDPN
    CIFCHKFYEEAKP
    LIEAGKLRVRYVVVAFLKPSSMPKAAAILGAADPAAAMAKNEKGFDAVTEEGGIAPAQNPAAATLSAVENNTRLLGESGE
    MATPTLIYCNSKGEPTLVHGLGKESFMDFAAHIGNLQNGACRK

    >gi|198283675|ref|YP_002219996.1| dihydrolipoamide dehydrogenase [Acidithiobacillus ferrooxidans ATCC 53993]
    MTIQYADLLTIGAGGGAYPAAFRLARAGRSVVMVDPKGLMSGNCLYEGCIPSKAVRETAEIYQSQRRFAERGLPGTITVD
    FAKIMAHKDSIQARRYQQHAADLAATPNIQLIQGEARFITPHEVAVDTADGERRFRCAQVIIASGSDVFVPPVPGAEF
    CL
    TSHDLYKPDATLKTLPERMIVIGGGYIGLETATFFAALGTRVTLLQKGRQLLNGMDPGMVALLTPLLDPSIRILTGVDVT
    AVEVTPEGGRRVHYTHGEENDTLDGDVVLMAVGRRPVIPAGAAEIGITVTRKGVAVGPDLQTVHPHIYACGDVNGRVPLF
    HAAVRQSMVAAHNILGGNIPMDYADFRHIPTTIFTLPAAAYVGITPALAEAQGIPLQTGRYDFEEDSRAQILERMEGGIQ
    LFFAADSLRLLGGWVVGIDAGSLIGQIGTAAAHGLTAYDLARFADQHPMSAEGIGKAARSLF

    >gi|198283723|ref|YP_002220044.1| disulfide isomerase/thiol-disulfide oxidase [Acidithiobacillus ferrooxidans ATCC 53993]
    MAAVPAKMTPSDLWKLMGKKLTYIQEGHHGPVVYDFTDTNCPFCHLIYVVEARLIREGKLTVRYVPVAIIKPSSMPEAAA
    ILQADNPVAALQKAEDAIDKGMKTGKPAKLARATDAIGKASPKTIEAIKKIEANNVFLQEVDIDELPDIIYLPKKGKLGL
    ITGLISEKKLTELLPQMQ

    >gi|198283755|ref|YP_002220076.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
    MAIVELTQDNFDAVVAGNDMVLIDFWAPWCAPCRAFAPIFEAAAEKYPDVVFAKVNTDTEQELATSFQIRSIPTLTIFRQ
    QIGIFSQAGSLPASALEEVIQQARALDMDKVREEISAQPDTTH

    >gi|198283788|ref|YP_002220109.1| alkylhydroperoxidase like protein, AhpD family [Acidithiobacillus ferrooxidans ATCC 53993]
    MSTEHARIAYLSFTKTAPEVYAALLAMGKAVDDSGLEKPLTELIKVRVSQINGCAFCIQYHLNVARQIGMEPVKLDLVAG
    WRDAGVFSAREQAALAWAECLTALATQGAPDAVYETLQSQFTETEVTFLTVAIGAINHWNRLGVGLRFSPPPPRTGSHV

    >gi|198283794|ref|YP_002220115.1| heavy metal translocating P-type ATPase [Acidithiobacillus ferrooxidans ATCC 53993]
    MVDVEIGIEGMTCASCSSRVERTLSRLPGVRAAVVNLSTEHAAVQYDPAQISPDALITAIAESGYTPVIAETELVIEGMT
    CASCVGRVERSLRRLPGVLEATVNLATERAALRYLPDTVDQNTLIAAVTAAGYGARPVQGDVAVADRKAQAIRTMRRDVI
    LAVVLAVPILLLSMGMALVPAVDRLLSGLEPFPQFWAWVQAVLATIVLAGPGRRFFRPGFLAYRHLSPDMNSLVATGTGA
    AWLYSMLVLVAPDWFPASARHVYFDSAAVVIAAVLFGKYLEELAKGRTSAAIKQLLGLQAKEAHVLRDGTELQVAIGAVV
    PGDQVVVRPGERLPVDGVVVDGDSHVDTAMLTGEPLPERKKQGDPVVGGTVNREGRLLIRATSVGQGTVLAQIIRLVEQA
    QTGKLPIQGLADRVVRIFTPLVILIALLSFFFWLLFGPPPAITLAMLSAVAVLVVACPCAMGLATPAAVMVGTGRAAELG
    VLFRKGAALEALAAVDTVCLDKTGTLTYGRPAVTRIDAADPAYLLQMAAAVESASEHPLAQAVLAAAGERHLDIPAVGDF
    TAFPGKGVRGRVDGVTVLAGTPAWMEEQGVVMAGFSTGDLQQTGGTNVCVARDGRLLGLLEISDVARPESAQVVRALGTL
    GLRVAMVTGDAEAAARVIAGRLGIDDIYAQVLPQDKAEIVRRLQAEGHKVVFVGEGINDSPALAQADVGMALASGTDIAM
    EAADITLTHGDLGGVITAIQAARQSMRTIRGNLFWAFFYNILLIPVAAGVAIPLGIQLNPMLAGVAMGLSSVFVLSNSLR
    LKRLQPWAAAP

    >gi|198284003|ref|YP_002220324.1| hypothetical protein Lferr_1896 [Acidithiobacillus ferrooxidans ATCC 53993]
    MTNDSGIQNIMNSFLMFCVLCLMSMSVAMAGDAPHGGSKAHILWTQILRHRVTYIQDGTHGPVIYDVQDPNCPYCHVLYE
    NEIPLIESGKLTVRYIPVAILTPGSQGEAAAWLQASHPLFALQHFENIVGDAFRSENTSTLPTVTASASTRIRLHDNLLI
    IRSLGVTGTPAIIYRTEGGRIKIAMGLISRRRLVAMLPYFK

    >gi|198284098|ref|YP_002220419.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
    MTSVILLCPACGAVNRVPKERLGENPKCGKCHAQIFPDHPVNLSSSSFSQYIQKNELPVLVDFWAPWCGPCRTMAPQFEQ
    AGRAMRGRVLFAKVNTEDEPQIGNRFQIRSIPTMVLFKAGKELARMSGAMSAAELQRWLTGQGV

    >gi|198284099|ref|YP_002220420.1| glutaredoxin 3 [Acidithiobacillus ferrooxidans ATCC 53993]
    MVKGAVVRMYATGTCPYCRRAEALLSSKGITPEILRVDRDPALRQSMLKLAHGRHTVPQVFINGRHVGGYDDLAALDRHG
    ALDDLLQENGQGDG

    >gi|198284100|ref|YP_002220421.1| Rhodanese domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MDHKILFFIESQWPLLLGAVALIIMIFKGPLTRRAAGIHEVDPATAVQLINHEDAVIIDVREQKEWSQGHLPGARHIPLG
    DLPKYMQDLEKHRGHHIICQ
    CASGMRSSRAAASLKKAGFDKIYSLRGGIGAWRSAGLPVEK

    >gi|198284172|ref|YP_002220493.1| glutaredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
    MAKVLLYTSPGCPDCAAVKRYLEMRGVAFDERDVTAPGVAEEAKSRYGVRVAPITVIDGGALYGTFAEQKSRLDAAFGG

    >gi|198284201|ref|YP_002220522.1| putative mercuric reductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MTENAPTELAITGMTCDGCAAHVRKALEGVPGVREAQVSYPDATARVVLEGEVPMQRLIKAVVASGYGVHPRSDGASSTN
    DGQELHIAVIGSGGAAMACALKAVERGARVTLIERSTIGGT
    CVNIGCVPSKIMIRAAHIAHLRRESPFDGGIQAVAPTIQ
    RTALLVQQQARVDELRHAKYEGILDGNPAITVLRGEARFKDSRSVVVHLNDGGERVVMFDRCLVATGASPAVPPIPGLKD
    TPYWTSTEGLVSESIPERLAVIGSSVVALELAQAFARLGSHVTILARGTLFLREDPAIGEAITAAFRAEGIEVLEHTQAS
    QVAYADGEFVLATGHGELRADKLLVATGRAPNTRRLNLEAAGVAINAQGAIVIDQGMRTNSPNIYAAGDCTDQPQFVYVA
    AAAGTRAAINMMGGSAALDLTAMPAVVFTDPQVATVGYSGAEAHRDGIETDSRTLTLDNVPRALANFNTRGFIKLVAEVG
    SGRLIGVQVVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFTRDVKQLSCCAG

    >gi|198284266|ref|YP_002220587.1| hypothetical protein Lferr_2176 [Acidithiobacillus ferrooxidans ATCC 53993]
    MSDYHYLEDQGEKSVVIVMTSGPSTAHRCATPFYLGALLSSMDAEVKIFCTMEAVRLMQTGVAENLSAMAGGKRIIDFIR
    DAKNAGVEIQV
    CRPALPGYEIEADNLIDEVDAVASAGDLADLILSVDRLLFF

    >gi|198284272|ref|YP_002220593.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MSAQDTVLVVGAGPAGLSAAATIASMGKKAVIVEKEDILGGAPIISGYAKLVPSGEWAKDAIGRMVSRVEGDGNISIHKS
    AKVTQVEGEAGNFTATLSNGDKVEAGAIILGTGFTHFDSINKPEWGFGTYEDVLTTTQMEQMVTAGQIR
    CPSDGRVPERV
    AILLCVGSRDRQIGREWCSKICCTVSTNLAMEIKEISPSTDVFIYYMDIRTFGLYEDKFYWKSQEEFKTKFVKARIAEVT
    KSPDGRLLVKGEDTLVKRPIVIPMDIVVHAIGMDPNALNPEIARTFGIGLEKHGFIDRAEQYTNSQGTTRKGIYVCGAAT
    GPEDIDSSVAQGQSAGARAVADLYGQQKIAS

    >gi|198284277|ref|YP_002220598.1| Rhodanese domain protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MYGFQEITADQLKALREQGGAFTLIDVRSPGEVARGVIDGARHLPLHLLPMSVQQMDKSQPLVFYCLSGGRSAQAAAFAA
    SQGFGQVLNLRGGISAWVNRGFPLVQLSS

    >gi|198284309|ref|YP_002220630.1| hypothetical protein Lferr_2220 [Acidithiobacillus ferrooxidans ATCC 53993]
    MEKISELGFWQRMAAERGLIILFFSSAGCHSCRIWRGLLREYEMTREDLRVWEVDAGIDMGLTQEFEVYHLPALFLFKDG
    RYLRPLQVEARPQALHRLVESVKDLPGEEQP

    >gi|198284312|ref|YP_002220633.1| Glutathione S-transferase domain [Acidithiobacillus ferrooxidans ATCC 53993]
    MKLYYSPGACSLSPHIILNEGGFSFDRERVDLASKKTETGADYAAINPDGYVPALLLDDGQVLTEGPAIIQYLADRVPEK
    KLAPPLGTLERYRLMQWLNFISTELHKGFSPLFHPQAPKEWKTVVAAQLGRRLSTVSRQLEGKDWLLGEGFTVADAYLFT
    VLGWGRHVGIDVEQWPVLQAYQGRVSTRPAVQSALKAEGLLQDT

    >gi|198284357|ref|YP_002220678.1| DsrE family protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MTIALIVLHAAPEADNPRADTAVRLAGAMLAEGKEVRLFLAGQGIGLLAPAREFAKSTRALFLELLDLGLTVQCCGTSLK
    SQGWAGSLPDGVTKSSMKGLSDWISAADEVVCF

    >gi|198284504|ref|YP_002220825.1| methylated-DNA/protein-cysteine methyltransferase [Acidithiobacillus ferrooxidans ATCC 53993]
    MGYPMPNEPLRLQMEHVATPLGTMLLVTDTQGRLRALDWADSEGRMRRLLQLHYGRQGFDLRMGAVQKHIHGCLDAYWSG
    DLGALNAVPVKTGGTAFQQSVWTFLRTISAGHTRSYQEQARAIGRGSAVRAVAGANGANPVGIVVP
    CHRVIGSDGSLTGY
    AGGIERKRWLLRHEGGNF

    >gi|198284550|ref|YP_002220871.1| thioredoxin [Acidithiobacillus ferrooxidans ATCC 53993]
    MAVSGHVLEVNLDNFQEAVVGLSRKVLVLVDFWAPWCAPCRALGPVLEKLAEEMGGAFVLAKVNSDENADLSRQYQVRGI
    PAVKAFKDGKVVDEFTGALPESAVRRFIEKNLPLPGDDLRVQALDAIAQGKAAEAQALLEQAISIHPGNDPARLALAHLA
    IQQGRHADAQAQIDAMSPTFQMETEVEGLKALLEFTETAHSAPSMTTLEATIASEKGDLRAQAMYQRSLLLLLQGQEEAA
    LDQLIEMVERHKNYQDGLARKTVLKIFALQGNRGPLVERYRSRLSRALH

    >gi|198284569|ref|YP_002220890.1| hypothetical protein Lferr_2488 [Acidithiobacillus ferrooxidans ATCC 53993]
    MKVQLLVSKWCPTCPQAEKIWAEAAQKLPMDLQILDVAERDGREVVSRLRIKTVPAVVVDGTLKAVGVQPLGDVLKLLGA


    >gi|198284638|ref|YP_002220959.1| methionine-R-sulfoxide reductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MTRSSAGFDLTPIDAGKRAEMAQGLSAEARHVLFEHGTEPPFCGGLLHEQGDGTFVCALCGLPLFRSAAKFDSGTGWPSF
    REPFAPDHIHEIRDTSHGMVRTEIRCARCDSHLGHVFSDGPAPTGRRY
    CLNSAALRFQRTT

    >gi|198284639|ref|YP_002220960.1| peptide methionine sulfoxide reductase [Acidithiobacillus ferrooxidans ATCC 53993]
    MLWTESVHHGVQVMALTIPAPDREDAAADAPGVAVLAAGCFWCVEAVYLGLAGVTRIVSGYTGGAAQTANYRAVCTGTTG
    HAEAVEIHYDPALLSFGRLLQVFFAVAHDPTQRDRQGNDVGTQYRSAIFTVNDAQMALARDYVAQLDQAKVFAGPIATEI
    TPLTHFYPAEDYHQDYARQHPDQPYICAVALPKVEKLRTRFPQWLRENQRR

    >gi|198284640|ref|YP_002220961.1| hypothetical protein Lferr_2560 [Acidithiobacillus ferrooxidans ATCC 53993]
    METEDRSGGKKARVGFGKSAGAALGTLFFGPLLLAGCATTPDLQSAEHLVQDNFHGKARVVKVFPGPTQKLTGIIAENSQ
    HQQGILWMLSNRYLLLGPVVNDKGQDITRAATEKYLPQPRKVPAGQIAPAAMKAPGFTIGHAGPLMVVFADPN
    CIYCHLL
    WEALQKPVADGQLRVKLIPVGFLKDSSAAKAATILAAPDPAAAWAENEKGFDKSTEEGGTRPLAQIPAEDMKAVHANTAL
    LQSSGEEATPTLLFCRKKSPDIHATKGETGLRMVLVHGIAVRGLPALIHSLGGDVSAEGCTP

    >gi|198284727|ref|YP_002221048.1| glutaredoxin-like protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MATIQELIQEQVQKHPIVLYMKGSPRAPQCGFSARAVQLLQQSGVKELFTVDVLADPQIRDGIKQYSNWPTIPQLYIQGE
    FVGGSDIMSDLYQQGELQKLVSSAQAASAG

    >gi|198284753|ref|YP_002221074.1| iron-sulfur cluster assembly accessory protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MMSTATETMTDLDSIPPVMTLTQNAADKIASLIEEEGSDDLKLRVFVTGGGCSGFQYGFTFDENMNEGDTEVHQLGVSLL
    IDPMSYQYLVGAEIDYSEGLEGAQFVIKNPNATTTCGCGSSFSA

    >gi|198284754|ref|YP_002221075.1| catalytic domain of components of various dehydrogenase complexes [Acidithiobacillus ferrooxidans ATCC 53993]
    MAEPYVIKMPQLSDTMTEGVLVSWEKPAGARVERGDVVATVETDKAIMDVEVFRSGYLAGPLAEANSVIPVGGTIGYITD
    SAVETVAAPVPAAPAVVPTGPASATPPAPEGYAVKMPQLSDTMTEGVLVSWEKAPGDRIQRGDVVATVETDKAIMDVEVF
    REGYLSGPLVAVDAVVPVGEAIAWLVESPEQVSHENAVHDGGLRQPDATSAPVATPLPAAAMSGPVPGADPAPRPQQGAA
    SPFARQLAGQRGVDINGLRGTGPAGVIVAADVLGAAGGRAAPVASSGTAEPAVPGNGRAMTAIERAISQAMAASLSIPVF
    HVTVQVRPEALIRAAKAHKLSVTVAIAKAASQALHRHPLVNAAYQPVDKIVERSQHDIGIAATTEDGGLIVPVLRGVEGK
    TPEQLQTEWTSLLEKARKRRLSPPEYTNPTFTISNMGMYGIAQFDAIVTPGTAAIIAIAGNGPEGMPITITADHRVVNGA
    EAALFLNDLKQAIEHPENWLGSGGPVIPEGDYDVQVLVIGAGPGGEDCARELAENGIRVAMVNDAPLPGGE
    CLWRGCIPS
    KAWRAAADRIRDREHDAAMGITLGTPRLDWAQLEQHRRGILQTRGEMALKTDQGVKIQVLEGYARFTGDHSVEISGKDAR
    TLTFGACVIATGAPAFVPPIPGIQDALKSGAAVTSDTVWNLKQPPARLCVIGAGAIGMEMAQMFHDFGAEVRVLEALPRP
    VAEMEKEVAEQLMKAIAHNSLRLQVLTGVKVTEVAGQPGQLEVRYQSGDEAANYACDLLLVATGKRPDTSGLNLAAAGVA
    LGDRAVIAVDASGRTNVPHIYAVGDVIGGYMLAHTAGQQGRVAAASLLGHSARYEAAKDCGVTFTRPQCAFVGLSLEQAR
    AEGIDAVEVKVPLSIDAKAMMTGETDGLIKIVADKISHRIVGVHFLADHADTLVGEAVMMVSAGLTLEQVAGAIHPHPTQ
    TELFGEMARRLLSRLRRSARAAS

    >gi|198284913|ref|YP_002221234.1| OsmC family protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MEARVQWMGPGQMSFVADADSGHALVMDGAAEIGGRNLGPRPMELLLMGLGGCSSIDVVMILQKSRQDIRSCVVELAAQR
    AEQDPKVFTGIHLHFVVSGKALDPKRVSHAIGLSAEKYCSASIMLGKTAAITHDYEIREEC

    >gi|198284171|ref|YP_002220492.1| Heavy metal transport/detoxification protein [Acidithiobacillus ferrooxidans ATCC 53993]
    MSDIRLKITGMTCGHCVRAVTKALEGVSGVEKADVTLTPGEAVVHGQASAAALIAAVKEEGYDTAVQD