Bdellovibrio bacteriovorus

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|42521808|ref|NP_967188.1| thioredoxin [Bdellovibrio bacteriovorus HD100]
    MAVVEITKNNIQEIVESNNMIILDFWATWCAPCRRFAPIFESVAAKHPDVIFGKIDTEAEVELADKFQIKSIPTLMIIKE
    SDIIFSQPGALPEEIFEQIVVKAKEIDMEEVRRENS

    >gi|42521877|ref|NP_967257.1| hypothetical protein Bd0252 [Bdellovibrio bacteriovorus HD100]
    MNQLQWKMNSPLGDLYMVASEMGLQSLYWGKTAGIPLAPSLTGKDGALKILKQTEAELTEYFKGQRQDFDVPLDVAGTEF
    QESVWRQLKKIPYGKTVSYTDIARRIKNEKAVRAVGTANGKNPICIIIP
    CHRVIAAGGGLGGYSGGLDRKRKLLNLEQSG
    GTPNTPAAKV

    >gi|42521937|ref|NP_967317.1| thiol peroxidase [Bdellovibrio bacteriovorus HD100]
    MASITLKGNPVNTSGTLPEAGTAAKDFKFVRNDLSEVSLHTFAGKKKVLNIFPSVDTGTCAASVRRFNQEASKLDNTVVL
    NISADLPFAQARFCGAEGIKNCETVSTFRSSFGKDWGVQIVDSPLAGLLSRAVVTLSADNKILYVEQVSEIVNEPNYEAA
    LASLK

    >gi|42521947|ref|NP_967327.1| arsenate reductase [Bdellovibrio bacteriovorus HD100]
    MTWVLLHNPSCSKSREAIEALRSIEGLEVRKYLEDPLDEAELRSLIQKLGTPVSSLVRTKEALFTEAPFDVNSTEKVIQH
    LAKKPKLMERPILIGSKAAAIGRPFEKIQELLEKN

    >gi|42521948|ref|NP_967328.1| putative vitamin B12 transport protein [Bdellovibrio bacteriovorus HD100]
    MSTLNHIEFNTADGKKATLADYSGKVLLVVNVASECGLTPQYEGLEKIHQKYESQGLRVLAFPANEFGAQEPGSNEQIQE
    FCRTQFGVKFPVFAKMVVKGEGQHPLYQQLTTLQPAAQQVPGGKLKSVLEEHGLLSGGPSDIMWNFEKFLIGKSGNVVAR
    FAPDMTPEDPTIVKAIEAELAR

    >gi|42521973|ref|NP_967353.1| putative arsenate reductase [Bdellovibrio bacteriovorus HD100]
    MLKVYEYAKCSTCVKALKFLDGKKVKYDKLPIVDKAPSQKELKDMLSALKERGGSIRNLFNTSGVMYKEMKLSEKLPSMT
    ESEAIKLLSENGKLVKRPFVIGDDTHLVGFKEDEWKKVF

    >gi|42521987|ref|NP_967367.1| hypothetical protein Bd0373 [Bdellovibrio bacteriovorus HD100]
    MTQDQKVENVIIIGSGPAGLTSAIYSSRANLEPLMIEGEEAGGQLMTTTEVENFPGFDHGITGPDLITVMRKQAERFGTR
    FITRNVTKVDFSQRPFKVWIGDKLHLAKSIIISTGASAKYLGLPSEKVYANRGVSA
    CATCDGAFFRNQEIGVVGGGDTAM
    EEAQFLTRFATKVYLIHRRDHFRASKIMVDRALKNPKIEVLYNTEVIEVLGDGKGMTGAKIKGTLDGAVKELPITGLFLA
    IGHKPNTDLFKGVLDMNETGYLITQPNTTYTNIPGVFAAGDVQDHVYRQAITAAGTGCMAAIDAERWLEAQEAH

    >gi|42522003|ref|NP_967383.1| 6-O-methylguanine-DNA methyltransferase [Bdellovibrio bacteriovorus HD100]
    MTNLEFKIYKVPSEFGEWLAAFEDDQLIFLGSYNAGKKLVEGDLTALIEKFYAVRIGSFQPAKWNQGNFWATQHQIKLQG
    TEFQMKVWLELLKIPAGKTVTYSELAKKLRKASAVRAVASAVGKNPISYWIP
    CHRVIGKGSNLLKYHWGPEVKEYLLMKE
    GAL

    >gi|42522126|ref|NP_967506.1| hypothetical protein Bd0522 [Bdellovibrio bacteriovorus HD100]
    MIRCPLLSQNEISSHTHAAPLRRFPMKKHLYDFTVKAANGQPVSLDQYRDKVVLVVNVASKCGYTPQYKGLEELYQQNKD
    NGLVILGFPCNQFGAQEPGSNEEIQQFCELNYGVSFPVMGKVDVNGGNADPLYQWLKEEAPGLLGTEMIKWNFTKFLVGK
    DGAVLKRFAPKDEPKDIADDIKKALA

    >gi|42522340|ref|NP_967720.1| methionine sulfoxide reductase B [Bdellovibrio bacteriovorus HD100]
    MADKVLKCGLPSDEGELKKILTPEQYRIMVENGTERPFQNAYWNHHEQGIYVDAISGVPLFSSDDKFDSGSGWPSFTRPI
    SADAVKEIADYSHGMTRIEVRASSSNSHLGHVFDDGPAPTGLRY
    CINSASLKFIPRKG

    >gi|42522357|ref|NP_967737.1| dihydrolipoamide dehydrogenase, E3 subunit [Bdellovibrio bacteriovorus HD100]
    MQNFDVVVIGAGPGGYVAAIRSAQLGFKTAVIEREFLGGVCLNVGCIPSKAMITATHLLHKAQHNFKEMGLNIKGGIDVD
    MKQLVKWKQSVSDKMSGGVNQLLKGYGVTIIKGDAEFKSSKEISVKSSAGTESVQAKYFVVATGSRPIEIPGFKFDEKDI
    CSSTGALAFDTIPKRVAVIGGGYIGLEISSYLRKLGTEVTVIEAQSALLAGVVDPDCAQIVTRKLTKAGVNVLYGAKAKG
    QKKVKDGYEVTVEINGKDEVVKCDKILVTVGRRPNGDQANLKAAGIQVDERGFVKVDAQRRTNVSNIFAIGDIAGQPMLA
    HKASHEGVLVAEVIAGHNRVYDAKTVPAVVFTDPEIAAAGMTEAEAKAKGHTDLLISKFPFAANGRAVSMMETDGFVKMI
    ADKKTHVLLGVHIVGPEASNLISEAVLAIEMGARIEDLALSIHPHPTLGETMMEAAEATLGHAIHIIQKPLKA

    >gi|42522366|ref|NP_967746.1| disulfide interchange protein [Bdellovibrio bacteriovorus HD100]
    MKALKLFGISALALTLVNCAPSAKQLKEAVEKDPSIVFAAIEKDPEQFIEVVNKAAQNAQRKAQEKAVAEEGKKRDDEFK
    NPLKPAIEEGRVIFGPKDAKVTIIEYSDFE
    CPYCAKGHATVDEVMKAYPKDVRVVYKHLPLDFHPMAMPAAQYFEAIALQ
    DAAKAEKFYNLVFENQGDLRTKKEGALKEAAKKAGADMKKLEKDLNSEVVKKRIEADMEEARKFNFSGTPGFLINGVSLR
    GAYPFADFKEIIDRHLAEAK

    >gi|42522488|ref|NP_967868.1| phage shock protein [Bdellovibrio bacteriovorus HD100]
    MLLAIAGSSFPESSMKKKIGLFLIFVGSLVSSSALAKEVLLDVRTPDEYSQSYLPGAINIDVLDKNFRTRVSELNRDDGY
    KVY
    CRSGKRATQAVTVMRELGFKTVTNLGGYEEAQRRLNLKPVHPK

    >gi|42522613|ref|NP_967993.1| hypothetical protein Bd1058 [Bdellovibrio bacteriovorus HD100]
    MKHLFMFFAVLGMFVGLNSEAKTTKAAKKGNTVSTSEVAYLAGGCFWGMEDLLRKLPGVTQTEVGYMGGDTKNANYNIVK
    TGTTNHAETVKITFNPEKITYQDLLLYFYKIHDPTTTNRQGNDIGTQYRSAIFYTSDKQRDEAEIVRARVDKSGAWKSPV
    VTQIVKAADFWSAEEYHQDYLQKNPGGYTCHFERKIEFKD

    >gi|42522729|ref|NP_968109.1| scaffold protein for iron-sulfur cluster assembly [Bdellovibrio bacteriovorus HD100]
    MNNLPGGSIRGSPALDSCVILAATLKELSMITISPEAATKLASLKKDEGKDDAAFLRVEVKKGGCSGLSYKMDFDTVTRD
    GDKFFESQGQKVAVDSQSMLYLLGMTLEYSGGLNGKGFVFNNPNANKHCGCGSSFNV

    >gi|42522824|ref|NP_968204.1| putative molybdopterin biosynthesis protein [Bdellovibrio bacteriovorus HD100]
    MREISCEQLKERMNEFRLVDVRTPEEYTGELGHIAGTELRPLGPELLDFLKTLNPSENIVFVCRSGARSGQTTLLSEEMG
    FTSTYNMVGGMLRWNEMGYAVTKGAGK

    >gi|42522831|ref|NP_968211.1| glutaredoxin [Bdellovibrio bacteriovorus HD100]
    MKPCLPHLPMSKRIMAKVLIYKKIPCPYCDRAMHLMDDRGIDYDVVDLTDKPEEIERIKTETGWRTVPIIMINGKLIGGY
    TDLKALDEEGKLMPLLQE

    >gi|42522861|ref|NP_968241.1| putative disulphide-isomerase [Bdellovibrio bacteriovorus HD100]
    MKVLGFILALFVAASAFGRLSDGKATFVVKDGKIVGTIQKGFHFNKEAPAAFAMKGVEIAPLVKEESQLVFAMPTKENEA
    FELGFYVCDDKKTVCEEHKITYVISGGKLKPASEVKKAEVAKPEVKATTGKVHKNSHGFIENDLEAAKVLAAKSKKNLLV
    DYGAPW
    CPACVRLETEVFGTKAFKNVTKDFILVALNADMSANKPFGKQYNIKAIPTVLILKPDGTELYRALDFAPADVYA
    KRIKDAKKNLQSTADLEKLAQAGDQKAIEALAVKAYNALDMETAVKWYRQIDSKSDRFASAETQWASQQARAEKKSEEYL
    AILKKWADLKPQSFTSVTATNEWAEFLKSEKKDLPADLKERLKANSEFLEKLTKSKADTVKWVESWEVSPMAPVERAEAL
    SMWKVSAEALGQKEEVVRIQQELQNEVRSLKLSENRPGEVMATLFYFRQAGLPELEESWLLKLEKANPHSYVPHMKLASY
    YVRNKAYEKALPQAKLAVELGEDLRLHNLKTLAEIQKELKQKDEAKKTIEIALAHPQVKEERFKDVLKSLEQMKKDL

    >gi|42522884|ref|NP_968264.1| methionine sulfoxide reductase B [Bdellovibrio bacteriovorus HD100]
    MKHWIFVMVFVFSAAISAKEKEYVKPSDAELKKTLTPMQYQCTQQSATEKPFDNAYWNNKREGIYVDIVSGEPLFSSTDK
    YDSGTGWPSFTKPIDDSSLVTKPDYEMSVERTELRSKKADSHLGHLFDDGPKDKGGKRY
    CINSAALKFIPVEEMQAKGYG
    QYLSLFPKYKKEKKK

    >gi|42522951|ref|NP_968331.1| putative NAD(FAD)-dependent dehydrogenase [Bdellovibrio bacteriovorus HD100]
    MGTSAELKGPNLSKGVDLSELREDKSLLGYVGEEPVILVRHDEEYFAIGATCSHYGGPLADGLVVGETVHCPWHHACFDL
    RTGEALKAPALNPVSAYNVEVRGSKVFVTSKKESTVRPREWSESQRYVIVGSGAAGTAAAIMLRKQGFIGSITIVSEDKS
    LPYDRPNLSKDYLAGNIPEDWVPLETEEFYQTHKIHFELSTKAEKVDAHRRSVFLSNGKTLRYDRLLLATGGEPIHPPIP
    GIKQDHVFYLRTLQD
    CQRIIGRTSWAQKVVIVGAGFIGLEVAAALRQRNLEVHVVAPEEMPLLKVVGVHVGSVLHKLHEE
    HGVIFHLGHTIKEIRQRSVLLDDGHSVDCDFVIVGTGIHPNTQLAEQAGCWVENGVLVNEYLETSVPGIFAAGDIARWPD
    PHSQRSIRVEHWEVAERQGQTAALNMMGDRIKFQDVPFFWTQHYDLSLGYVGHSDRFDRMDVMGDLNSRDFAVAYYEDQK
    VAAVLTLGRDRESLLVEEAIGQYDEKKIHEIFHQHERDHHP

    >gi|42522952|ref|NP_968332.1| osmotically inducible protein [Bdellovibrio bacteriovorus HD100]
    MQRKGSAHWQGNLQNGSGELSTESGALKNLPYSFSDRFENGMGTNPEELIGAAHSGCFAMALSGALAKKGFNAESLDVSA
    TVTLEKSGDGFVIQSSKLKLRALVPGIDRKLFETIAQDAKVN
    CPVSKVLKAEISLEIDFHELRSPSATAH

    >gi|42523292|ref|NP_968672.1| bacterioferritin comigratory protein [Bdellovibrio bacteriovorus HD100]
    MAAKIELGKKVPNFKIPSSSGETLSLSSLKGKKVVLYFYPKDSTPGCTIEGIEFNDLLAQFKKQNAVVFGVSRDSLKSHD
    KFICKYDFKFELLSDEDEELCQLFDVIKEKNMYGKKVMGIERSTFVIDEDQKLVGEFRKIKAQGHAAEMLKFIKDL

    >gi|42523424|ref|NP_968804.1| hypothetical protein Bd1947 [Bdellovibrio bacteriovorus HD100]
    MIKSKVRTASKGFPRAFSCDLPPPPLEYAHQGETMRIFTLIALILCTSFAWAKDTPSSFFDLSANSLSGKKVNFSTYRGK
    VVLVVNTASQ
    CGFTPQLKELEEMYKKYADRGFVVLGFPSNDFKQEKGTNDEVQTFAAKEFGVTFPLFDKAPVSGKDIQPV
    YQFLTTQKPGLIFKDVAWNFEKFLINRKGQVVERWSSITKPSSDSITKSVEKALNEPL

    >gi|42523457|ref|NP_968837.1| cytochrome c biogenesis (thioredoxin) [Bdellovibrio bacteriovorus HD100]
    MNKALIGKIVNGLLVVAVLWVLINRLPGVIENFRKQNQPAPSFAVPLLDGTLFESEETGKALVVVFWATWCGPCEVELSR
    LQKLIDDKVIPADSVLAVSSLEDRHLVQKTVDQRRYSFLVGVDISGQVAGLYGVRATPTTALLDKNHQLTWITTGLSPLL
    EVKIRGLFK

    >gi|42523577|ref|NP_968957.1| Thiol:disulfide interchange protein dsbA precursor [Bdellovibrio bacteriovorus HD100]
    MKNTVSKSKFLLIAMIATLIGVGVHIYLTLHYYDIKFGLSAGDSMCNINEVLNCDAVTASKFSALLGVPIALWGVMTNLV
    LVYFLGVTRFNLVQDPDRTSRYALLLSGVTVLASVVMGLISVTAMSNLCIFCISAYVLSLVGFIFTWMGAEDVTAENISN
    DIKDIFTSERWVAGFLLAIPAFAFLANIMYLESHGLSDMEKMAKEKVAYWQVAPQQNFDLTKGLSMQKGTDEPVMTIVEF
    ADFR
    CGHCKHAAAPLHSFTKNHPDVRLIYKPFPLDGTCNEAMKGGGGDGISCGLAFATLCSEKIAQKGWVAHDYIFDNQE
    EITRMMNLDKNLESIAKATGIQLEELKTCVKGTEIPEIVRNTAKEGEVAQIRGTPAIFVNGKLLDGGQLIPVLEAAYKTL
    KK

    >gi|42523598|ref|NP_968978.1| hypothetical protein Bd2131 [Bdellovibrio bacteriovorus HD100]
    MSESLNYYVTAYYRFTKLADLPAIQKALEDKAEELNVKGLVILGDEGYNSTCAASSIESFEAWKTFIREYFNSPDQFFKD
    SESTKSPFRRFKVKVRNEIVTTGIPGVMPPEGVNHHLSPTEWNKVMKEETDYVMIDTRNWYEYKIGTFKGALNPNIEKFT
    EFPQYIEAQGIPKDKKMLIF
    CTGGIRCEKGILELQDKGYNNVFQLDGGILNYMKEYPNDQFEGECFVFDHRVAVDQNLQP
    TTKFGLCPHCGQPSTIKIECKRCDAHELICEDCIKVEYAKDTCSKNCAYQLEKHPARKGQKQLVPFEIEKMKAEGKDTGS
    IPQIRVTRTKYISLNKNGEAETRSTKETAE

    >gi|42523629|ref|NP_969009.1| hypothetical protein Bd2165 [Bdellovibrio bacteriovorus HD100]
    MGHMACQTKWVGGIGFESQIRDHKVAMDSRSDGGKDQGPSPKELLLASICGCTGMDVISILQKMRVGLQSCSVDADTDTT
    AGYPSIFDRVKLKFLVKGEMKNEQLMKAVVLSMTKYCGVSAMVVKASPIDYEVYLNDVKIGEGQADFESAKA

    >gi|42523669|ref|NP_969049.1| cytochrome c biogenesis (thioredoxin) related protein [Bdellovibrio bacteriovorus HD100]
    MRFLAAFFVFIMASSGLAKEMPSTAVFKRLPTVTLGKSDIKTLKDLQGKVVLVDFWASWCEPCKAALPHYNSLYKKYRSQ
    GLVVIGVNEDEDLAERDAFLKTVKLDFPLFHDQGRLVLEDFKVLALPTLYVFDKKLKPVVFYRGYDEKNSQALEKKIQEL
    LKQ

    >gi|42523682|ref|NP_969062.1| copper-transporting ATPase copA [Bdellovibrio bacteriovorus HD100]
    METQGNSAELQLIGMSCVNCAGKIEKTLNGLPGVTATVNFATEKAQVNLGDSPLTVGNLIKTIQELGYQAFEVNSEVDAQ
    KIKEEAAAEYRKELRLFIVSAILTAPFLVEMAMMLTGAAHEMIPRWVQWILATPVQFWVGWRFYRGSYYALKSGSANMDV
    LVALGTTMAYGLSAVMTVMDWHHHHVYFEASTAVITLILLGKLMESRAKGKTSEAVEGLLRLQPKQAMVERNGEVVALDI
    TELVAGDIVIVKNGESIPVDGLVVQGVSSVDESMLTGESMPVQKGIDDRVYAATLNQEGSLRIKATGVGSKTQLAQIIKI
    VTTAQGSKAPIQRLADKISAVFVPVVVGISVLTFIGTWLWTGDLTMALISSVSVLVIACPCALGLATPTAVVVGIGKGAQ
    AGVLFRDAKALELAEKIDILVLDKTGTITEGKPVVTEIHVTAGQDRNQVLSFAASLEAGSSHPLAHAILEEARKEGLSLH
    TVQNFKSVMGQGVEGQIGNQSLKLGRSAWVAPEFSLNQDLLKELESKGQTLMVLADEARVLGYIAVADRIRESSKEAIAE
    IQKRGVKVMMLTGDNEGTAREISRQAGITDFKHSVKPADKANVIVTLKRKKLRVAMVGDGINDAPALAMADVSFSMSSGT
    DIAIETADVTLMKNDLRSVAQAIQLSHLTLKKIRQNLFFAFIYNVLGIPLAALGMLNPVIAGAAMAMSSVSVVSNSLLLK
    RKKI

    >gi|42523729|ref|NP_969109.1| spb1 gene forserine protease (AJ428902) related protein [Bdellovibrio bacteriovorus HD100]
    MRSNLIFAFFLLFSQISIGAEKLTNLSGIDVLTNETKTFTMENHKATVIVFLSAKCPCSASHENLLKDLAQQYKDFQFVG
    IHSNSDETLEETQKHFREAHLLLPVIRDSRSQWANKLGALKTPHAFVLSPTGEMLYHGGVTDSHVGPSAKKHFLKEVLED
    LHAGKPPRHKEGRALGCYIQRADET

    >gi|42523902|ref|NP_969282.1| thioredoxin [Bdellovibrio bacteriovorus HD100]
    MGTFTKAVTDTSFDAEVLNSSTPVLVDFWAEWCGPCRALAPKLEEVAQELGAKVKIVKVNVDENPSVPGKYGIRGIPAML
    LFKGGSEVGQLVGNHPKDAILEFLNKNV

    >gi|42523944|ref|NP_969324.1| alkyl hydroperoxide reductase, C22 subunit [Bdellovibrio bacteriovorus HD100]
    MQTIINTKVPDFKVQAFHHGDFKTVTQNDLKGKWSIFFFYPADFTFVCPTELGDMADKYAEFQKIGVEVYGVSTDTHFTH
    KAWHDASETIKKIKYPMLADPTFQLTRAFGVHIEEEGLAYRGTFLVNPEGKIVLAEVQDNGIGRNADELFRKTQAAQYIA
    ANPGEVCPAKWTPGKSTLKPGLDLVGKI

    >gi|42523945|ref|NP_969325.1| alkyl hydroperoxide reductase, subunit F [Bdellovibrio bacteriovorus HD100]
    MLDSSLLEQLRSVFGSLENTVELVYENSSHEDQKDLLDMLQSVASTSDKITLTQNTSGTSPMPQFRIDYKGKHTGIVFKG
    IPGGHEFTSLILAILNTDGKGKLLDSVIADRVRRLNKNITIQSYISLT
    CENCPEVVQALNQIALIHGSLRHEIIDGGYVQ
    DDIKTLGIQGVPSLVANAKMFHSGRIQLLDLVSKLESTFGVDANAAPSEPVNKNLGHFDVLVIGGGPAGASAAIYTVRKG
    LSTAMITEKIGGQVQETKGIENLIGVTYTEGPQLAAQLNQHIASYPVKVLENRRVKKIHTESKVKAIELESGEHLTADAI
    IVTTGAKWRELGVEGEKEYLGRGVAY
    CPHCDGPFYKGKKVAVIGGGNSGVEAAIDLAGIVREVVVFEYNDQLKADKILVD
    KLKSLPNVSIVTSAKTEKVIGDGNKVQQIQYLDRSLNKEEKMDLDGIFVQIGLVPNSQFLKETVELTKFGEIIVDEKGRT
    SAKGIYAAGDVTTTPYKQIVIAMGEGAKAALAAFEDRMYHS

    >gi|42523994|ref|NP_969374.1| selenide, water dikinase [Bdellovibrio bacteriovorus HD100]
    MTSTKISLTQTVQKGGCAAKVAASELREILKQVKFPAAHPALMVDGGLFDDAAIYKINDEIALVQTLDFFTPIVDTPKLF
    GEIAAANALSDVYAMGGKPKTAMGILAFPLATLPKEVIVDVMQGASDKIAEADANFVGGHSIDDDTLKFGLSVTGFVNPQ
    QVWTNAGAKVGDHLILTKPLGTGTLTAGLKRQEVQEADIMEALQSMATVNNAVDYMTPVLKNEVHAATDITGFGLSGHGM
    QLANASQVSLRISFSKIPRFAKALAFLEKGFLTKAHRSNAEYTKEAISVAGLESLQQHLLHDPQTSGGLLLSVSREVSAD
    MVQALRAKFKSAEIIGEVLPRQDKAVIFEP

    >gi|42524029|ref|NP_969409.1| cation transporter E1-E2 family ATPase [Bdellovibrio bacteriovorus HD100]
    MQRFTAPVPLAENRFPDYFLEHDPDHIGVGMLMAHLRHPGDTMNTANLHECAYCRAGTTEPVYCCSACETLDLHVRQIPV
    LSEQQNPYAYLDQPEFRRLYSHDKQDFNFLFFAEGLH
    CSSCVHLLEKLPEFYDRIAMARVNFGQSTVAVKLAEGGSLAQV
    AHVIAELGYKPSPLAAQDNLAARYQSENRSFLKRIAVAGFCAGNTMLFVIPVYSGLAGTWATVFNWLSFALFLPILLYSA
    QPFYKGAWNSLKYKVINVDLPIAIAMLSGFALSTANLVRGDGDIYFDSTASFMFFILSARYLLKRVQQNYLSPSRMKSFF
    QMEKYERISGDTSAVIPWSSVNAGDVLKLKQGQSLPSDATLLSSHATLDMSLFNGESLPKVFSSGMTLFAGTKILDDGVL
    VRMNLQFSESKLGQLLQQLDHGALKKSRFIALTDRLAQWLIITVFSIAVLFFIAYASIDISEAFNRSLALIVLACPCALA
    FGSPLTFGLALKKSQRLGILLKDATSLERMLEVKNIFFDKTGTLTEGHLSLSHSEPAIISPRLQANILALEATSYHPLAF
    ALRQAWPHPEFMPAVQNAQEILGKGVKGLIDGKLYEIRHLSESTHEDETAIEVLCDGQSLCRLYFLDELRQDSAQAVQEL
    NKRGMNCFLLSGDKKSRVYQAANQCGIARENAHGELFPEDKKDILIRHKNTCMIGDGANDSLSLQAADVGIAVKGSVDLS
    LNSADVYFTRGGLSPFFDLLKISEQTQNVLKRNLGISLTYNTIGGILALAGFIDPLMAAILMPISSVVIILSSLWGFR

    >gi|42524147|ref|NP_969527.1| dihydrolipoamide dehydrogenase [Bdellovibrio bacteriovorus HD100]
    MADTQFDLIIIGSGPGGYVGAIRAAQLGLKTAVIEKDKTYGGTCLNVGCIPSKALLESSEHYQAAQHDLAAHGVKVSKVD
    LDLPTMQARKDKVVKTNTEGIAFLFKKNKITPFNGMGKIVAAGKVEVKGADGNTQILTAKNIVIATGSVPVELPFLKYDE
    KRIVSNTGALALDQVPKSMIVVGGGVIGLELGSVWQRLGAKVTVIEYANRLGGTMDQDCMNVLKKSMEKEGMSFLLSTKV
    TGSKVGNDGVEVTYESLTDGKASSMKADVVLVSTGRKAFSAGVGCEEMGIQKDPQGRIIVDKHYQTNVPGIYAIGDVIAG
    PMLAHKAEEEGVALAEILAGGAGHVNYDTVPGVIYTHPEIASVGITEEFAKEKGLEINVGKFPFMANGRARAKGYTEGFV
    KIIADKKTDKILGAHMVGPSVSELIHEVIVCMEFGGSSEDLARSFHAHPTLSEVVREAALAVEKRQRQM

    >gi|42524176|ref|NP_969556.1| hypothetical protein Bd2764 [Bdellovibrio bacteriovorus HD100]
    MALTFTPFPDLGNKCPDFTLPAVDGKTYSLKDFSNGQPLVVMFICNHCPYVQAIEDRLIQLGHDLKKQNVNVIAICANDE
    ESHNREDSFENLQKRAQEKGYPFVYLHDKSQAAAHAFGAVCTPDYFVYDKDLKLAYRGRLDDSWKEAAKVTKRELFDAVQ
    TLLKNEKVSEEQTASMGCSIKWV

    >gi|42524293|ref|NP_969673.1| hypothetical protein Bd2887 [Bdellovibrio bacteriovorus HD100]
    MATTHERIDQIVKGNKIVLFMKGTQQFPMCGFSARACAILQDMGVQFHDVNVLDDDEIRQGIKEYGNWPTIPQLYINHQL
    VGGSDIMMEMYQSGELQELLK

    >gi|42524350|ref|NP_969730.1| thiol:disulfide interchange protein tlpA [Bdellovibrio bacteriovorus HD100]
    MSWKGSPMKQHLKAFGIVFILAAAGLWAYTQFFASKLNQAPAGYATIEAMEKEGVPNFVTKDLDGKPVELESFKGKVVIL
    NFWASW
    CGPCIEEVPSLIKLIKEFKGDVQLIAVSGDSSRNDIDVFMKSFPEMKGANIHIVYDEDRSLMKQFQVARLPESL
    VLGTDHKLVKKVVGSIEWFNKDSVAYVQSLLAAKPAQ

    >gi|42524631|ref|NP_970011.1| thiol:disulfide interchange protein [Bdellovibrio bacteriovorus HD100]
    MRKPPNTITNTTNIPTKPIRYDLSVSLSDRTVLILSQSQINLPMVRRDTKRKLMRISLLYVVAILLSLITSPRSWAADPN
    DTDPLLAETKVVPYEWSPGQGGNIEIKMTLPEGYHAYEDKFSVVILEPDGFKVAPFKIEPIVEWHDKFSKKMRSGVEKAA
    TLTAHIEAPHRFLKKHTKMKMELTYQACSDQFCLFPTTKLIEVPIVVTMVEGESQILEADVQPMAAPTDFFDTANFQKYL
    GSSMIAGLIFVFFAGIFTSFTPCIFPMIPITLAVLGNHSNERTRLQNFFTSCIYVLGIATTYSLLGLAAASSGGLFGASL
    GNPYVLTVVCAIFLAMALSMYGLYDLQVPAFLRNKLGRGTKKQGVIGVYLTGLFAGIVASPCVGPVLVAILTYVASTQNK
    MMGFLYLFVYALGLGLIFIVLGLFNQLANSLPRSGPWMNAFKFILGTLMLSAFYYYLELLLPARWFDGALAIGLIVLASI
    YGAFLPAKGQSALRHIQKGLMQALLVVGIGYAVIAVLDLRPYIRGQMMGGASINQIQKLNWRPYSDAALAQATKEQKPVI
    IDFWADW
    CAACLELEEHTFTDPRVRAMSENYVLLKFDATKDSPELRELKKKYHIQGLPTVVFINPHGVWIDALTLTQFEK
    APEFLKRMEKGRQ

    >gi|42524877|ref|NP_970257.1| hypothetical protein Bd3525 [Bdellovibrio bacteriovorus HD100]
    MPMINQPAPHFAAQAVFDGGEVKDISLNDFKGKWVVLFFYPLDFTFVCPTELTQFREHLKEFQNAGATVIGCSVDSVHSH
    KRWLRDDLGNLGYPLMADLTKRIARDYGVLFEDRGIATRGTFIIDPDQKIQYMGIHNTSVGRDAKEILRVLQGCQTGELC
    QAGWKAGDEHITPIK

    >gi|42524901|ref|NP_970281.1| rhodanese-related sulfurtransferase [Bdellovibrio bacteriovorus HD100]
    MKFVNFTSKTENPHFEGIYDIGPAELLQNKANVVMIDVRQPEEYVGELGHVEGSSLMVLDTLPEQLGTLPKDKTVVFICR
    SGGRSAKATAFAKMNGFEEVYNMQGGMLLWNDLQLPVTK

    >gi|42522825|ref|NP_968205.1| hypothetical protein Bd1303 [Bdellovibrio bacteriovorus HD100]
    MMNSILMALAGGALIGLAASLMLILNGRVTGISGIVNGFIGDVRKDLWRGAFILGLLIGGLVLGALQPDMFVNTSGRSVG
    VVLIAGLIVGFGTVMGSG
    CTSGHGVCGIARFSVRSLVATATFMILGMLTATLFKALVGG

    >gi|42521921|ref|NP_967301.1| putative stress-induced protein OsmC [Bdellovibrio bacteriovorus HD100]
    MVKMSGVYQGHKHSEIKHGPSGAALETDAPKDNNGKGESFSPTDLVGAAMGSCMMTVMAIAAEKDGVELKGARFEVEKEM
    GVNPRRIVKLNVVLHMPQSIPHDYRKKLEQIAMT
    CPVKQSVHPDMQVPVLFHYDI

    >gi|42524026|ref|NP_969406.1| signale peptide [Bdellovibrio bacteriovorus HD100]
    MKLSKVHFVAIAFLMAGPVQAGDHDHHHHQAAPAAEKSKPLHDESIYNLNSSLLDEDGKVFQLEKYRGKPVVISMAYTSC
    VYTCPLILAQMQQLEKALAEQGKKDVRFVLVSFDPAKDTPKVLKDYAKKKKLSTQWNLLTSKSDKEPREIASVLGIKYSK
    VEGGDYDHSFIITVLDAEGVPRGRQVGAAGNPKDLIKFIP