Baumannia cicadellinicola Hc Homalodisca coagulata uid58111

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|94676797|ref|YP_588521.1| 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate synthesis protein [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MLNDQDFLRYSRQLLLEDIGTTGQKQLEAATVLLVGLGGLGSPASMYLAAAGVGTLLLADYDNIHITNLQRQILYRTRDI
    GELKAKVAQQNLTALNPQVHYIPLIRRLQNSTWLDMQVKRANIVLDCSDNMLTRHAINAACVRCSIPLISASAVGFSGQL
    IVLTPPFSSGCYACLFPSIQEKEHN
    CRTIGILGPVVGIMGTIQALEAIKLICGLPMETVGKLLLFNGKKLQLRVLALSIN
    QHCLICANHTSSNIGKL

    >gi|94676549|ref|YP_588564.1| glutaredoxin-related protein [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MINTVSQLQQQIAEYPILLYMKGSPKLPSCGFSAQAVQILSNCSKSFAYINILTNPYIRTELPKLANWPTYPQLWVDGNF
    IGGCDIVMEMYQHGELQILIQKTINKYPSHTYNEPIEIS

    >gi|94677026|ref|YP_588646.1| thioredoxin 1 [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MKDKIINISQENFTQQVLQNEGLFLVDFWAEWCAPCKSITPILAEIANEFNGKVTIVKLNIDENPAIAQKYNVRSIPSLL
    LFRNGEVVATKVGALSKGQLIEFLNANI

    >gi|94676722|ref|YP_588679.1| HesB family protein [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MNEMIRFPLQLTDSAINRIKTLIAEEANPHLKFRVYITGGGCSGLQYGFTFDDKVNEEDIAIEKQGVVLIVDPISLQYLL
    GGLVDYSEGLKGSRFFIINPNVQTTCSCGSSFSMT

    >gi|94676661|ref|YP_588707.1| thiol:disulfide interchange protein DsbA [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MKKSFLLTTIKNSKQRYKKVCFPFIISLLFIKSAFALSFYEGKEYICIDKPDYSAPNVLEFFSFYCQHCYLFDEVYKMNS
    RITKLLPNHIKVTKYHVNYLGPLSKQLTKAWAVAMILGIEDKISPLIFYAVQQTKSIHNQYDIRELFLKAGVSAQEYDSA
    WNSLAVKSLQKKQENTATNLKLVGVPSFFINGKYIIKNEGLDMTSTEVYITDLSNVIKFLINK

    >gi|94676766|ref|YP_588723.1| thiamine biosynthesis protein ThiI [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MKQKDNYITQQLEVIRSFGINDVILDIRTPDEQEESPLLLKNIVMQHLPFYKLSSHFATLDQSKCYLLYCTNGVMSRLQV
    LYLREQGFNNVKTYYIYD

    >gi|94676663|ref|YP_588769.1| thioredoxin-disulfide reductase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MHNIRHNNLIILGSGPAGYTAAIYAARANLNPVLITGIEKGGQLVTTTEVENWPGDSKDLTGSILMERMHIHATKYNTEI
    ISDNIIKVNLKQYPFSLKGDHTTEYTCNVLIIATGASARYLGLSSENEYKGKGVSA
    CATCDGFFYRNLKVAVIGGGNTAV
    EEALYLSNIAKEVHLIHRREIFRAEPIIMDRLMYKVNFGNIIIHKNKIVQNILGDKSMVTGIQLQHSNADKLETLAVSGV
    FIAIGHSPNTTIFENQLVLQNGYIKVQAGINGNATATSVPGVFAAGDVIDKNYRQAITAASSGCMAALDAQRYINTQNK

    >gi|94676951|ref|YP_588895.1| rhodanese-like domain-containing protein [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MLCLHNKICRNKLHQNILAETEPRTTISFYKYFDIQNPNLFRDRFYLQMNELKIFGRIYIAKEGINAQISVLNSRINAFR
    TMLYTSHPQLDQLRLNFALDNNRQSFWMLRMKVKKLLVADGIQEPNFNCFNANNYLKAEEVNILLENPNILFIDMRNNYE
    YEVGHFQHAMEIPSRTFREKLPIAIKMLQHNKERKIVMY
    CTGGIRCEKASAWMLHNGFQHIFQVEGGIIGYVNRAVKLGL
    PLKFIGKNFVFDDRLGERITSDVIAYCHQCKNSCDDHTNCLNQDCHNLFIQCRQCTKKYDGCCSLSCQQTLRTRITRLKN
    NFIK

    >gi|94676493|ref|YP_588904.1| iron-sulfur cluster assembly accessory protein [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MITKLNLQDKIWYGLTMTDAAARQIKKLVTSDPRMFGLRLSINHSGCAGFSYILDLITEPNKSDLVYEHLGAKLFVPLQV
    MPLIDGTRIDYIKIGLNYEFKFYNPKAQHACGCGESFSI

    >gi|94676976|ref|YP_588941.1| pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MNNTLKTNVVIIGAGPAGYSAAFRCADLGLQTILVERYSKLGGVCLNVGCIPSKTLLHIAKVITETKVLSQHQLLFGEIK
    ADLNQVRIWKDKIINQLTKNLYNLAQKRNITVINGYGKFINDKNIIINNNNHITNVIFDNAIIATGSSPITLPFLNIKDP
    RIWNSTDALTLPFIPKKMLVIGGGIIGIEMAYIYSTLGSEIDIIEMSNQIIPAADEDIANLFNKHIRNKFKLMLETKVTA
    IEPRTNGIAVEILLKDNKKYIQYYDVVLIAIGRIPNGKLLNTTQIGIKVDDFGFVSVDKQMRTNIKHIYAIGDIVSQPML
    AHKGIHEGYVAAEVIADKISYFDPKVIPSIIYTEPEVAWTGITEKEAKNKNINYEKSIFPWFASGRAITSYSQDGMTKLI
    FEKNTRKIIGGAIIGTNGGELLGEISLAIEMGCDAEDIAMTIHAHPTLYESIGLSAKIYEGTIVDLLSTK

    >gi|94676826|ref|YP_589022.1| anti-oxidant AhpCTSA family protein [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MVLVTRQAPDFTAAAILGSGKIINNFNFKNYIKGQHAIIFFWPMDFTFVCPSELIAFDKRYLEFQKRRVKIVGVSCDSEF
    VHNAWRLVPPDKGGINQVQYPMVADVKREIIKAYDIEHPDIGVALRASFLIDKDGIVRHQIVNDLPLGRNIDDIIRMVDA
    LQFNEEHGLVCPAQWEKGQDGITATTEGVAKYLAKNVSKL

    >gi|94676997|ref|YP_588987.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)]
    MRILLANPRGFCAGVERAINIVEKVIAIYGPPIYVRHELVHNSYVVNTLRNQGVVFIEQIHEVPDGAVIIFSAHGVSKAI
    RKEVQSRNLTIFDAT
    CPLVTKVHMEVARASHKGIETILIGHYGHPEVEGTIGQYNNTDGGIYLVESLEDVWQLKVKNKNN
    LCFITQTTFSVDKSSAIIDALRQRFPFIKGPHKQDICYATTNRQEAVRNLTMATDIVLVVGSKNSSNSNRLVELAQQTGK
    PAYLIDCASDIKENWLQGINIIGVTAGASAPNILVLQVILKLQSFGAESAEELRGYEEKMIFDLPRNLHVVNK