Bartonella quintana Toulouse uid57635

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|49473709|ref|YP_031751.1| thioredoxin [Bartonella quintana str. Toulouse]
    MTCIKTDKCNFENEVLASSVPVVVDFWAEWCGPCKMIAPILDEISTEMQGQIKIAKVNIDENPELATQYGVRSIPTLLMF
    KNGKASSNMVGAASKGRVSEWIKDGLR

    >gi|49473781|ref|YP_031823.1| Thiol 3A-disulfide interchange protein [Bartonella quintana str. Toulouse]
    MKITPQKPKKNTSLSVLFGLFGPFVLFLLIMLFFNFTDSKYPNDTFLLPNALAEKPAPKTNLPLLNNENHFDLEQFKGRI
    ILVNFWGSW
    CLPCREEHPLLMKITQDQRFDLIGINYKDNKENAQRFLNNFGNPFKFIGFDVSGHTAINWGVYGPPETFLL
    NKEHIIIAKYVGPLTWQVYQKEILPKIEKIITTEEILNGNILTHKDNLSFSLY

    >gi|49473847|ref|YP_031889.1| glutaredoxin-like protein nrdH [Bartonella quintana str. Toulouse]
    MPVTIYSKPSCVQCDATRRAFDAKGINYRVVDISRDEQAYSFVQSLGYRQVPVVVCGKSHWSGFRPDMISGLCV

    >gi|49473890|ref|YP_031932.1| molybdopterin biosynthesis protein MoeB [Bartonella quintana str. Toulouse]
    MTQEAKTNLSSEEIERYARHIILPEIGGVGQQKLKAARVLVIGAGALGAPVLTYLAAVGVGTLGIVDDDIVSLSNLQRQV
    IHKTSTINQCKTDSAKATIKAINPHVMVEKHSLRLDKSNVDKLLNAYHIIVDGSDNFATHYLLADHAAQCAKPLISGAVE
    RFDGSLTVLMPYKDNNPHYRDLFPNPPAPGTIPT
    CAETGIVGVLPGVIGTLQAMEAIKLITNIGEPLVGKILLYNGLSAQ
    FNIITYKRPDSSANTASIKVCV

    >gi|49473950|ref|YP_031992.1| glutaredoxin [Bartonella quintana str. Toulouse]
    MKEVTLYTRPNCPYCAKARDLLDKKGVKYTDIDASTVLREEMVQRANGRNTFPQIFIGDYHVGGCDDLYALNAKGELNSL
    LQSVE

    >gi|49474015|ref|YP_032057.1| hypothetical protein BQ03750 [Bartonella quintana str. Toulouse]
    MIKCRSFLSFAIIFALMTIVQISATAILAAEVKPVSNVDMAEVLQPGKVKDRVEGEANAPVTIVEYASLTCAPCAHFYND
    VLPQIRKKYIKTGKVKLIFRDFAFDPRATAGFMLARCAPEDRYFPLIEVLFQKQHEWVWEQDALTPLKKIGLMAGFTDES
    FNACLKNQSILDEVNMSFERGKKLGVTATPTFFINGNKYTGVMSVEAFFSVIDSFLKN

    >gi|49474040|ref|YP_032082.1| methyltransferase (fragment) [Bartonella quintana str. Toulouse]
    MLDISKKRIFCLKNVSIGVLLVAKSHKGICDIALGDTTEQLFQEVMLRFGDVQQVDDDRIFKREVAHIIAMIETPKLVRK
    HDFSLDINGTIFQQKVWAVVCDVPCGETISYKLLAQRIGMPNAFRAVAHACACNKLALVIP
    CHRVVGKNGCISGYRWGNE
    RKQILLQREQNENI

    >gi|49474130|ref|YP_032172.1| dihydrolipoamide dehydrogenase [Bartonella quintana str. Toulouse]
    MANLYDVIVIGSGPGGYVTAIRAAQCGFKTAIVEREHLGGICLNWGCIPTKALLRSAEIKHFSEHVKDYGLKINGSIEAD
    IKDVVARSRRVSARLNAGVGFLMKKNKIDIIWGEAKLTKKAKESQLAEIMVSSSSKPVMQPQNSVPKETLGEGTYQAKHV
    IIATGARPRSLPGIEPDGKLIWTYFEAMIPHTIPNSLLVMGSGAIGIEFASFYHGMGAEVTVVEMMPHIMPTEDIEISAF
    ARRQLEKKGIRILSQAKVTRVEKASNSVTAHIDVNGKIETITVDRLISAVGVQGNIENLGLEALGIRTDLECIVTDEWGW
    TGVKGIYAIGDVAGPPMLAHKAEKEGVICIEHLAGLKNAHPLDKKKIPGCIYCTPQVASVGFSEAAAKEAGYDIRVGRYS
    FSANGKAIALGEDQGLVKTIFDKKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEELIHTVFPHPTLSEMMKESVLDAY
    DQVLNA

    >gi|49474146|ref|YP_032188.1| hypothetical protein BQ05250 [Bartonella quintana str. Toulouse]
    MSRFSVVNLTQAAMDRVKAVMDAKDARGILIGIKKGGCAGMEYTITLVKEEVPDADVVEVNGARVFIAHDAVLFLLGTQI
    DYEVTTLRSGFVFKNPNQVSACGCGESVELRPALQSQLNERYEA

    >gi|49474203|ref|YP_032245.1| bacterioferritin comigratory protein [Bartonella quintana str. Toulouse]
    MTRQMKGTSAPDFDLPRDGGGRLCLSDLQGKPIVLYFYPKDDTSGCTSEAIDFTRLKRKFDEIGVVIIGISPDNIDKHNK
    FKTKHGIDIILVSDEEKTTLQAYGVWVEKSMYGRKYMGVERSTFLIDSTGTILEEWRKVSVSGHAENVLACCYTFYRNSS


    >gi|49474275|ref|YP_032317.1| glutathione reductase [Bartonella quintana str. Toulouse]
    MGSFDFDLFVIGSGSGGVRAARLAGGLGKRVGIAEEYRIGGTCVIRGCVPKKLYVYASQYAQEFKKSVGFGWEYADPIFS
    WKKLVAAKNKEISRLEELYRKGLQNNNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVPNTAIKGSDLCLTS
    NEIFDLEKLPKSIIIVGGGYIGVEFANIFHELGVKTTLLHRGNLILRNFDYDLRQLLNDAMIEKGISILYGASISQVQAI
    GSSYNIVLSSGQMISADQVMFATGRVPNTTGLGLEQAGVKLNEFGAVIVDERMTTNIPHIGAVGDVTGHIQLTPVAIHDA
    MCFVKTVFENTPTKPDYDLITTAVFSQPEIGTVGLSEEDAARRYKHLEIYRTVFRPMRNVLAGSSEKMFMKLVVDSESRI
    VVGAHILGENAGEMAQLIGISLKGKLTKDIFDETMAVHPTMAEELVTMYKPSYLYENGEKVEK

    >gi|49474339|ref|YP_032381.1| hypothetical protein BQ07520 [Bartonella quintana str. Toulouse]
    MTTVHDFIDNEIKTNDVILFMKGIPEAPQCGFSGQVVQILDYLGLKYKGINILTSDELRQGIKEYSNWPTIPQLYIKGEF
    IGGCDIVKEMFQSNELQELLKEKKISFNLL

    >gi|49474354|ref|YP_032396.1| hypothetical protein BQ07680 [Bartonella quintana str. Toulouse]
    MNVNISDVAAKRIAQILLSETDKIGLRISVEGGGCSGFSYKYNLVSETSEDDLVLKKDGAVVFIDSLSLPFMEGAEIDFV
    DDLMGQSFQIHNPNAVSSCGCGVSFSI

    >gi|49474487|ref|YP_032529.1| thioredoxin reductase [Bartonella quintana str. Toulouse]
    MVQPHIRLLIVGSGPAGYTAAIYAARGMLEPVLVTGLQQGGQLTITTDVENYPGFADPIQGPWLMEQMAKQAENMGTKVV
    YDSIIKADLLKRPFILYGDSGTQYCCDALIIATGAQVRWLGLESEQTFMGGGVSA
    CATCDGFFYRDKDVIVVGGGNTAVE
    EALYLSHLAKRVSIVHRRNHFRAEKILQDRLFACDNVRVIWDHVVEEIVGLPAHASMGAVVTGVRLKNIKTGQKIKVDTD
    GIFIAIGHDPAVSLFEGQLKQKPGGYLWTAPDSTATSIAGVFAAGDVVDNIFRQAITAAGMGCMAALEAERFLDLQI

    >gi|49474547|ref|YP_032589.1| hypothetical protein BQ10070 [Bartonella quintana str. Toulouse]
    MEKNFKVAALYCFADLKHYRQLQKPLLDLCQAKDIKGTLLLAQEGINGTIAGSCRAIEELVNFIKTEPAFQTPEIKYSWA
    SKMPFHRMKVRLKKEIVTMGVEGINPLKIVGTYVDPEDWNALIQDEETLLIDTRNDYEYAIGSFQGAIDPGIKTFREFPE
    WVRKHEADLKKKKKMAMF
    CTGGIRCEKSTAYVRELGYEQVYHLKGGILKYLETIPKEESLWWGECFVFDERVSVKHGLEE
    CGRELCRACRSPLNAEGKLSPHYEAGVSCDACYNKRSEVDRERFRERHRQIQLSKLRAMHSHQE

    >gi|49474601|ref|YP_032643.1| hypothetical protein BQ10800 [Bartonella quintana str. Toulouse]
    MIKKTVPNATFHTRVRDESIGGNNPYRWQEVNSDTYFKGKRVILFSLPGAFTPTCSTFQLPDFEKLYDEFKKVGIDEIYC
    LSVNDAFVMNAWKEAQGIKNVKLIPDGSGEFTRKMGMLVAKDNVGFGMRSWRYAAVIHDGVIEKWFEEEGYSDNCTTDPY
    EVSSPQNVLKALKG

    >gi|49474658|ref|YP_032700.1| hypothetical protein BQ11650 [Bartonella quintana str. Toulouse]
    MTCILSSRSLLNRHLHCEPSRKEQSLWAFFLFFCLSATIGLLLGFEHIGGYLPCDLCLIERFLYYSAIPFLILAGFGAWF
    FRMSFWVQLLFLCVFVLMSISLVLGMYHAGIEYGFWLAPSS
    CGSRAPRVITDVTQLFNRLNNIHPPSCSETSTRFLFLSF
    AGWNVVSSLFYMLTSLYIASKGLLSDHLKL

    >gi|49474788|ref|YP_032830.1| Thiol 3adisulfide interchange protein [Bartonella quintana str. Toulouse]
    MVSQILNSTKHNNKKIQLLIAFFIITVALSLCTTTSNHNKRESFFSNFISTAKAQQTNIDKTQIEKRMAIKKAAKGFFTH
    IRFTDTPYDMNQLSFKDIQGQDHKLAEFTGKPMLINLWAIW
    CTPCRMEMPELAQLKRELGGKNFDVMAINVDQAASPEKI
    QQFLQNVHADNLLYYCDETMTIFNSLRKQGLALGLPLTLLIDKNGYLIASFNGAAPWANNDAKTLIKAVIREAQ

    >gi|49474812|ref|YP_032854.1| dihydrolipoamide dehydrogenase [Bartonella quintana str. Toulouse]
    MSYDVVVIGAGPGGYVAAIKAAQLGFKTAIIEKRMTLGGTCLNVGCIPSKALLHTSEVFAETQHGFEKLGISISKPKLNL
    EQMMAHKKAVVTANTSGISFLMKKNKIDTFFGTAKILSAGQIEVVARDGNKQTIATKNIVIATGSESSGIPGVNVKIDEK
    IIVSSTGALALEKVPMRMIVVGAGVIGSELGSVWSRLGSKVTIIEYLNKVLGSMDGEVSRQFQKLMEKQGIEYKTGTKVT
    AIMQSGSTAQVTFETIKGGASETLEADVVLIATGRFPYTEGLGLVEAGVKLDERGFIAIDANWQTNIPGIYAIGDVVKGP
    MLAHKAEEEGVAVAEILAGQKGHVNFDVIPSVVYTQPEIASVGKTEEELKAAGIDYNVGKFLFTANGRARAMQKSDGFVK
    ILADKKTDRVLGGHILGFGASEMIHEIAVLMEFGGSSEDLGRCCHAHPTLSEAVREAALATFAKPLHI