Bartonella henselae Houston 1 uid57745

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|49474855|ref|YP_032896.1| thioredoxin [Bartonella henselae str. Houston-1]
    MSCIKVDKSNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQNQVKIAKVNIDENPELATQYGVRSIPTLLMF
    KDGNIASNMVGAASKGRVSEWIKEGLR

    >gi|49474929|ref|YP_032970.1| Thiol 3A-disulfide interchange protein [Bartonella henselae str. Houston-1]
    MKITPPKPEKNISLPLFFDLVGPFVFFLLLLMFLFYFMQSKHPNDTSLLPNTLAEKLAPKISLPLFDNENYLLNSDQFKG
    RVTLINFWGSW
    CPSCREEHPLLMKIAQDQRFDLIGINYKDNKENAQRFLNNFGNPFKFIGFDVSGYTAINWGVYGPPETF
    LLNKENIIIAKHVGPLTWQIYQKKILPKIEKAIMTEEILKNKRLIYKDNLSSSQY

    >gi|49475004|ref|YP_033045.1| glutaredoxin-like protein nrdH [Bartonella henselae str. Houston-1]
    MPVTIYSKPSCVQCDATRRAFDAKGINYRVVDISRDEQAYSFVQSLGYRQVPVVVCGENHWSGFRPDMISGLCV

    >gi|49475053|ref|YP_033094.1| molybdopterin biosynthesis protein MoeB [Bartonella henselae str. Houston-1]
    MIQEANTKLSNEEIERYARHIILPEIGGVGQQKLKAARVLVIGAGGLGAPVLTYLAAAGVGTLGIVDNDIVSLSNLQRQV
    IHKTNTINQCKTDSAKATINAINPHVTVEKHTLRLDKSNVGKLLNAYHIIVDGSDNFATRYLLADHTAQCAKPLISGAVG
    RFDGSLTVLMPYKDNNPHYRDLFPNPPAPGTLST
    CAETGIIGALPGVIGTLQAMEAIKLITNIGEPLVGKILLYNGLSAQ
    FKVITYKRSDSNAN

    >gi|49475200|ref|YP_033241.1| glutaredoxin [Bartonella henselae str. Houston-1]
    MKEIILYTRPNCPYCKRARDLLDKKGVKYTDIDASTSLRQEMVQRANGRNTFPQIFIGDYHVGGCDDLYALENKGKLDSL
    LQDVH

    >gi|49475253|ref|YP_033294.1| hypothetical protein BH04560 [Bartonella henselae str. Houston-1]
    MINYRSFLSFAVIFALMTTMQISVTTVLASGVKPVSTVDMAELLKSGKAKDRFEGEENAPVTIVEYASLTCVHCAHFYND
    VLPQIRKKYIKTGKVKLIFRDFAFDSRATAGFMLARCAPEDRYFPLIEVLFQKQSEWVWARDAVTPLKKIGLMAGFTDES
    FNACLKNQSILDEVNASFERGKELGVNATPTFFINGNKYEGAMSVEAFFSVIDSFLKN

    >gi|49475277|ref|YP_033318.1| methyltransferase (fragment) [Bartonella henselae str. Houston-1]
    MLNISQQRIFCLKNVSIGGLLVAKSRKGICNIALGDTPEQLLQEFTVRFGDVQQVDDDSTFKKEVTHIVAMIESPKFVRK
    HDFPLDIIGTVFQQKVWTGLCEVPCGETISYEALAQHIGMPNAFRAVANACARNELALLIP
    CHRVVRKDGFISGYRWGIW
    RKKILLQREQKGEI

    >gi|49475371|ref|YP_033412.1| dihydrolipoamide dehydrogenase [Bartonella henselae str. Houston-1]
    MANLYDVIVIGSGPGGYVTAIRAAQCGFKTAIVEREHLGGICLNWGCIPTKALLRSAEIKHFSEHLKDYGLKLNGSIEAD
    IKDVVARSRAVSARLNAGVGFLMKKNKIDIIWGEAKFTKKAKGSQLVEITVSSSSKPIMQPQNPVPKGTLGEGIYQAKHI
    IIATGARPRILPGIEPDGKLIWTYFEAMIPHVMPKSLLVMGSGAIGIEFASFYHDMGASVTVVEMMPHIMPAEDIEISTF
    ARKRLEKKGIRILSQAKVTKVEKAVDSITAHIDVKGKRETITADRLISAVGVQGNIENLGLEALGIKTDRGCIVTDEWSW
    TGVEGIYAIGDVAGPPMLAHKAEEEGVICIERLARLENIHPLDKRKIPGCTYCTPQVASVGLSEAAAKEAGYDIRVGRYS
    FSANGKAIALGEDQGLVKTIFDKKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEELMHTVFPHPTLSEMMKESVLDAY
    GQVLNA

    >gi|49475431|ref|YP_033472.1| glutathione reductase [Bartonella henselae str. Houston-1]
    MGSFDFDLFVIGSGSGGVRAARLAGALGKRVAIAEEYRIGGTCVIRGCVPKKLYFYASQYAQEFSKSIGFGWKYADPIFN
    WEKLVAAKNKEISRLEGLYREGLQNSNVHIYESRAVFVDEHTLELSVTGERISAEKILIATGAKIVSNSAIKGSDL
    CLTS
    NEIFDLEKLPKSIVIVGGGYIGVEFANIFHGLGVKTTLLHRGDLILRNFDYDLRQLLNDAMVAKGISIIYEATVSQVQST
    ENCYNVVLTNGQTICADRVMLATGRVPNTTGLGLERAGVKVNEFGAVVVDEKMTTNVSHIWAVGDVTGHIQLTPVAIHDA
    MCFVKNAFENTSTTPDYDLITTAVFSQPEIGTVGLSEEDALHRYKRVEIYRTVFRPMRNVLSGSPEKMFMKLVVDGESRI
    VVGAHVLGENAGEIAQLIGISLKGKLTKDIFDKTMAVHPTMSEELVTMYKPSYVYENGEKLDN

    >gi|49475511|ref|YP_033552.1| hypothetical protein BH07400 [Bartonella henselae str. Houston-1]
    MSRFSVVNLTEAAVDRVKEIMNTKDARGILIGIKKGGCAGMEYTITLVKEEILDADVVEFNGARVFIAHDAVLFLLGTQV
    DYEVTTLRSGFVFKNPNQVSACGCGESVELRPASQTQLNETYQAS

    >gi|49475572|ref|YP_033613.1| Outer membrane protein [Bartonella henselae str. Houston-1]
    MITQPQYLKTKRITKFLITVTLSILLCSPSLSNERSSEKTLQNLKTQLLEDSSFLSKLREKITPHIDDHDIQKIIRDYLL
    TNPEIIIEMQLILQDKLEKQSAQNTQKQASIINSLKKQIFQSPYDAVLGNPNGKRVLVDFFDYN
    CGYCKISYPYIENLIK
    EYPDLRVIIKDLPILGSDSMAAHIVAYAFRKQFPEKYPQFYKELLTHQSRANEIKAIKIAVSLGADEKKLRNAIKDSSLQ
    NAFKKNIQIASRLNITGTPSYIIGDKLLIGAVSEEILKEAIENMQ

    >gi|49475631|ref|YP_033672.1| bacterioferritin comigratory protein [Bartonella henselae str. Houston-1]
    MTKQMKGTPAPDFNLPRDGGDKLCLSDLQGKMVVLYFYPKDDTSGCTNEALDFTRLKTKFDEIGVVIIGISPDNVKKHEK
    FKIKHALDIILVSDEEKTTLEAYGVWVEKSMYGRKYMGVERSTFLIDPTGTIVEEWRKVSVSGHAENVLAAATFLYRKSL
    SI

    >gi|49475726|ref|YP_033767.1| hypothetical protein BH09760 [Bartonella henselae str. Houston-1]
    MTTIRDFIDSEIKENDVILFMKGTPDAPQCGFSGQVAHILNYLGVPYKGINILTSDELRQGIKDYSNWPTIPQLYVKGEF
    IGGCDIIKEMFQNNELQELLKEKDIPCNKA

    >gi|49475741|ref|YP_033782.1| hypothetical protein BH09960 [Bartonella henselae str. Houston-1]
    MGVNISDAAAKRIVQILSSEPDKIGLRVSVEGGGCSGFSYKYNLVSETNEDDFVLKKGGAIVLIDSLSLPFMEGAEIDFV
    DDLIGQSFQIHNPNAVSSCGCGVSFSI

    >gi|49475890|ref|YP_033931.1| thioredoxin reductase [Bartonella henselae str. Houston-1]
    MVQSHVRLLIIGSGPAGYTAAIYAARGMLKPVLITGLQQGGQLMITTDVENYPGFADPIQGPWLMEQMAKQAENMGTKIV
    YDNITKADLSKRPFILYGDSGAQYCCDALIIATGAQARWLGLESEQVFMGGGVSA
    CATCDGFFYRDKDVIVVGGGNTAVE
    EALYLSHLAKRVSVVHRRDYFRAEKILQDRLFARDNVCVLWDHVVEEIIGLPARASIGAVVTGVRLKNVKTGQKVHVDTD
    GIFIAIGHDPAVSLFEGQLKQKSGGYLWTAPDSTATSIAGVFAAGDVVDDVFRQAITAAGRGCMAALEAERFLELQI

    >gi|49475959|ref|YP_034000.1| mccB protein [Bartonella henselae str. Houston-1]
    MEQQYILGKYTRVVVHKKNAIFGAGSKQFIINDRKHWENLVLLAAQWIEKKTKEETYNSLSSIMSRENFNRAFNFLFSNH
    FLVLAETSDNIFHNRYSRSHLHYQSYGMHPASVQHTLSQKVVVILGCGGIGNHVSAILASSGVGKLILVDNDVIEMTNLT
    RQILFTEEDIGLPKTTVLQRELIRRNSQSEVHELQMFITEKEDINKLPKADLWIISADSPDMLRPWINEWCVKNKQAYIN
    SGYVNDIAIFGPFYIPGQTGCYACSTSIENLPEKGDSLIHEA
    CTAINNNFKVATFPPVNALSAAMCANDALKFLGGYGNL
    LSIDRRVGIWSSQLFTEERSLKKNPHCKVCGTPQ

    >gi|49475975|ref|YP_034016.1| hypothetical protein BH12760 [Bartonella henselae str. Houston-1]
    MEKNFKVAALYCFADLKHYRQLQKPLLDLCQAKDIKGTLLLAQEGINGTVAGSCAAIETLVDFITAEPAFQMPEIKYSWA
    SKMPFHRMKVRLKKEIVTMGVDGVNPLKAVGTYVDPKDWNALIQDEETLLIDTRNDYEYAIGSFQGAVDPRIKTFREFPA
    WVLKHEADLKKKKKIAMF
    CTGGIRCEKSTAYVRELGYEQVYHLKGGILKYLETIPKEDSLWWGECFVFDERVSVKHGLEE
    CGRELCRACRSPLNTESKLSPHYEEGVSCDACYNTRSEDDRERFRERHRQFQLSKLRAMHSHQE

    >gi|49476039|ref|YP_034080.1| hypothetical protein BH13580 [Bartonella henselae str. Houston-1]
    MIRKTVPNTTFHTRVRDESIGGDNPYRWQEVNSDAYFKGKRVILFSLPGAFTPTCSTFQLPDFEKLYDEFKKVGIDEIYC
    LSVNDAFVMNAWGKAQGIKNVKLIPDGSGEFTRKMGMLVAKDNVGFGMRSWRYAAVINDGVIEHWFEEQGFSDNCATDPY
    EVSSPQNVLKTLKG

    >gi|49476270|ref|YP_034311.1| Thiol 3-disulfide interchange protein [Bartonella henselae str. Houston-1]
    MIHQNITSLKKKKRKTRIFIACFFVAVILVGIGLYITKEPHDKRTPFFTNFISRENTGKLQEEKMVAIKKAAKGFFSHLR
    FADTPSDMNQLSFKDLQGKDHKLSEFTGKPMLINLWAIW
    CLPCRTEMPELAQLKRELGGKNFDVIAINIDQAASPEKIQQ
    FLQNINADNLLYYRDETMSIFNNVRKQGLALGLPITFLIDKNGHLIASFNGAAPWANDDAKALIKAVIKEAQ

    >gi|49476301|ref|YP_034342.1| dihydrolipoamide dehydrogenase [Bartonella henselae str. Houston-1]
    MSYDVVVIGAGPGGYVAAIKAAQLGLKTAIIEKRMTLGGTCLNVGCIPSKALLHASEVFAETQHGFETLGISIAKSKLNL
    EQMMAHKKAVVTANTSGVSFLMKKNKIDTFFGTAKILNAGQIEVVARDGNKQTIETKNIIIATGSESSGIPGVNVEIDEK
    VIVSSTGALALEKVPTRMIVVGAGVIGSELGSVWSRLGAKVTIIEYLNKVLGSMDGEVSRQFQKIMEKQGIEYKIGAKVT
    AITQSGSVAQVTFEAVKGGPSETLEADVVLIATGRFPYTEGLGLEEAGVQLDERGFITIDAHWQTNIPGVYAIGDVVKGP
    MLAHKAEEEGVAVAEILAGQKGHVNFDVIPSVVYTQPEIASVGKTEEELKAAGIDYNVGKFPFMANGRARAMQKSDGFVK
    ILADKKTDRVLGGHILGFGAGEMIHEIAVLMEFGGSSEDLGRCCHAHPTLSEAVREAALATFAKPLHI