Bartonella grahamii as4aup uid59405

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|240849708|ref|YP_002971096.1| thioredoxin [Bartonella grahamii as4aup]
    MTCIKVDKDNFESEVLTSSTPVVVDFWAEWCGPCKMIAPILDEISMEMQNQVKIAKVNIDENPELATQYGVRSIPTLLMF
    KNGNISSNMVGATSKGRLSEWIKDGLS

    >gi|240849782|ref|YP_002971170.1| thiol: disulfide interchange protein [Bartonella grahamii as4aup]
    MKNITPKLKKNISLPVLLVFFGPFVLFLLLMVLFFNFMDKKYLQDSSLLPNALAEKSAPNIHLPLLDKESYLNSKQFKGR
    VTLVNFWGSW
    CLPCREEHPILMKIAQDKRFDLIGINYKDNKTNALRFLNSFGNPFKFIGFDVSGYTAIDWGIYGPPETFL
    LNKESTIIAKHVGPLTWQIYQKKILPKIEQALMTEEK

    >gi|240849858|ref|YP_002971246.1| glutaredoxin-like protein NrdH [Bartonella grahamii as4aup]
    MSITIYSKPSCVQCDATRRAFDAKGIHYRVVDISCDEQAYSFVQSLGYRQVPVVVCGENHWSGFRPDMISGLCA

    >gi|240849902|ref|YP_002971291.1| molybdopterin biosynthesis protein MoeB [Bartonella grahamii as4aup]
    MTQETDTKLNNKEIERYARHIILPEIGGAGQQKLKKARVLVVGAGGLGAPVLTYLAAAGVGTLGIVDNDIVSLSNLQRQV
    IHKTNAINKRKTDSAETTIKAINPHVVVEKHTLRLDKSNVDKLLNAYHIIVDGSDNFTTRYLLADHAAQCKKPLISGAVE
    RFNGSLTVLMPYKDNNPHYRDLFPTPPAHGTIPT
    CAETGIIGVLPGVIGTLQAMEVIKMITNIGEPLVGKILLYNGLLAQ
    FNIITYKRSNYKENAIVIKKLGES

    >gi|240850050|ref|YP_002971443.1| glutaredoxin [Bartonella grahamii as4aup]
    MKEIIIYTRPNCPFCTKARDLLNKKGVKYTDIDASTSLRQEMVQRANGRNTFPQIFIGDYHVGGCDDLYALEAEGKLNSL
    LQGV

    >gi|240850103|ref|YP_002971496.1| DSBA oxidoreductase [Bartonella grahamii as4aup]
    MVKYRSFLSFGIIFLFITIAQNSVTVALARDPKPVATVDMEEILQSGKVKDRFEGEADAPVVIVEYASLTCTHCAHFYND
    ILPQIRKKYIKTGKVKLIFRDYAFDPRATAGFMLAQCAPEDRYFPLIEVLFQKQNEWAFGKDALTPLKKIGLMAGFTDES
    FTACLKNQAILDEVNASFERGKKLGVTATPTFFINGSKYEGAMKVEDFFSVIDSFLKK

    >gi|240850165|ref|YP_002971558.1| thioredoxin reductase TrxB [Bartonella grahamii as4aup]
    MVQSHIRLLIIGSGPAGYTAAIYAARAMLKPVLVTGLQQGGQLTITTDVENYPGFADPIQGPWLMEQMAKQAENMGTKIV
    YDTIIKADLLKYPFVLYGDSGTQYSCDALIIATGAQARWLGLESEQTFMGGGVSA
    CATCDGFFYRDKDVIVVGGGNTAVE
    EALYLSHLAKSVSVVHRRGQFRAEKILQDRLLACKNVRIIWDHVVEEIVGLPAQGAVGAVVTGARLKNVKTGHEMTVNAE
    GIFIAIGHDPAVSLFEGQLKQKRGGYLWTAPDSTATSIAGVFAAGDVTDEIFRQAVTAAGRGCMAALEAERFLDISKR

    >gi|240850170|ref|YP_002971563.1| methyltransferase (fragment) [Bartonella grahamii as4aup]
    MLNISQTRIFCLKDVSIGKLLVARSQKGICYIALGDTIEQLLQEFTIRFGNAQQVVGDNTFKREVAHIIAMIETPKLVKK
    YNFSLDINGTVFQRQVWAVLCDIPCGETISYEVLACRIGIPNAFRAVANACARNELAVIIP
    CHRVVRKNGFISGYRWGSK
    RKQILLQREQNGGI

    >gi|240850264|ref|YP_002971657.1| dihydrolipoamide dehydrogenase [Bartonella grahamii as4aup]
    MANLYDVIVIGAGPGGYVTAIRAAQCGFKTAIVEREHLGGICLNWGCIPTKALLRSAEMKHFAEHAKNYGLKINGSIEAN
    IKDVVARSRGVSARLNAGVDFLMKKNKIDIIWGEAKLTKEAKGSHPAEIMVSSSSKPIMQPQNPVPKGTLGEGAYQAKYI
    IIATGARPRVLPGIEPDGKLIWTYFEAMIPPAMPKSLLVIGSGAIGIEFASFYRDMGAEVTVVEMMPHVMPAEDIEISTF
    ACKQLEKKGLRILRQAKVTKVEKSSDSVTVHIDVQGKIESMTVDRLISAAGVQGNIENLGLEALGIKTDRGCIVTDEWSW
    TGVEGIYAIGDVAGPPMLAHKAEEEGVICIEHLAGLKNAHPLDKRKIPGCTYCTPQVASVGLSEATAKEAGYDIRIGRYS
    FAANGKAIALGEDQGLVKTIFDKKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEELMHTVFPHPTLSEMMKESVLDAY
    GQVLNA

    >gi|240850326|ref|YP_002971719.1| glutathione reductase Gor [Bartonella grahamii as4aup]
    MGSFDFDLFVIGSGSGGVRAARLAGGLGKRVAIAEEYRIGGTCVIRGCVPKKLYVYASQYVKEFKKSVGFGWKYADPIFS
    WEKLVAAKNKEISRLEGLYRKGLENNNVHIYESRATFVDDHTLELSATGERVSAEKILIATGAKVAPNTSIEGGGF
    CLTS
    NEIFDLDQLPKSIVIVGGGYIGVEFANIFHELGVKTTLLHRGDLILRGFDHDLRQLLSDEMTEKGISILYGVTISKVQAA
    ENCYEVILSNGQTISADQIMLATGRVPNTTGLRLERAGVQVDEFGAVVVDERMTTNVPHIWAVGDVTGHIQLTPVAIHDA
    MCFVKTAFENIPTTPDYDLITTAVFSQPEIGTVGLSEEDAVRRYKRLEIYRTVFRPMRNVLSDSSEKMLMKLIVDGESRI
    VVGAHILGENAGEMAQLIGIALKGKLTKDIFDETMAVHPTMAEELVTMYKPSYIYENGKKIES

    >gi|240850609|ref|YP_002972009.1| bacterioferritin comigratory protein [Bartonella grahamii as4aup]
    MTRSMKDAFAPDFNLPRDGGETVCLSDFKGKPVVLYFYPKDDTSGCTSEALDFTKLKMKFDEIGVAVIGISPDNVKKHDK
    FKVKYELDVILVSDEEKTTLEAYGVWVEKSMYGRKYMGVERSTFLIDANGIIAEEWRKVSVSGHAENVLATATLLHHNGN
    L

    >gi|240850672|ref|YP_002972072.1| outer membrane protein [Bartonella grahamii as4aup]
    MTHHSQNSKITPLSKILVPVMSSILIFLPSLSNATSHSKTANHLSLEKLKTQLLEDSSFLSKLKEKMIPHTDSHHIQQIV
    REYLLTHPEVLIEMQLILQDKLEKQNEYENKIQTSVIHLLEKKIFHSPHDAVLGNPNGKKVLVNFFDYN
    CGYCKSSYSHI
    EDLIKEYPDLKVIIKDLPILSSDSMAAHTVAYAFRKQFPEKYPQFHKTLLMYQGRANEAKAIKVAVSLGEDETKLRNAIK
    DPTLQNAFKENIQIASKLHITGTPSYIIGNKIFIGAARQDTLKQAIDNTR

    >gi|240850706|ref|YP_002972106.1| putative FeS assembly scaffold SufA [Bartonella grahamii as4aup]
    MSRFSVINLTEAAVDRVKAIMDAKDAQGILVGIKKGGCAGMEYTITLVKEKGIDADVVEVNGARVFVAHDAVLFLLGTQM
    DYEVTTLRSGFVFKNPNQVSACGCGESVELRPATQDQYKTN

    >gi|240850735|ref|YP_002972135.1| glutaredoxin-like protein [Bartonella grahamii as4aup]
    MTTVHDFIDNEIKTNDVILFMKGTPDAPQCGFSGQVVQILDYLGLNYKGINILTSNELRQGIKDYSNWPTIPQLYIKGEF
    VGGCDIVKEMFQNNELQELLKEKNIPCNQS

    >gi|240850750|ref|YP_002972150.1| iron-sulfur cluster assembly accessory protein [Bartonella grahamii as4aup]
    MNVKISDVAAKKIAQILLREPDKIALRISVEGGGCSGFSYKYDLVSEMCKDDLVLKKDGAVVFIDLLSLPFMEGAEIDFV
    DDLMGQSFQIHNPNAVSSCGCGVSFSI

    >gi|240850983|ref|YP_002972383.1| putative peroxiredoxin [Bartonella grahamii as4aup]
    MIKKTVPNVTFHTRVRDEVGENNSYRWQEVNSDAYFKGKRVILFSLPGAFTPTCSTFQLPDFEKLYDEFKQAGIDEIYCL
    SVNDAFVMNAWGKTQNIKNVKLIPDGSGEFTRKMGMLVAKDNVGFGMRSWRYAAVINDGVVEQWFEEAGFSDNCATDPYE
    VSSPQNVLKALKS

    >gi|240851014|ref|YP_002972414.1| putative rhodanese-related sulfurtransferase protein [Bartonella grahamii as4aup]
    MEKNFKVAALYCFADLKHYHQLQKPLQDLCQAKDIKGTLLLAQEGINGTVAGSCAAIEALVDFITAEPAFQTPEIKYSWA
    SKMPFHRMKVRLKKEIVTMGVEGVDPLKVVGTYVDPEDWNALIQDEETILIDTRNDYEYAIGSFQGAIDPQIKTFREFPE
    WVRQHEADLKKKKKIAMF
    CTGGIRCEKSTAYVRELGYEQVYHLKGGILKYLEKIPKEESLWWGECFVFDERVSVQHGLEE
    CGRELCRACRSPLNAESKLSPHYEEGVSCDACYNTRSEADRERFRERHRQFQLLKLRAIDSHQGT

    >gi|240851356|ref|YP_002972759.1| thiol:disulfide interchange protein [Bartonella grahamii as4aup]
    MISQIFISEKNNKKRQFSLAFFIIALSLYATTNYDNKRESFLFNFISAAKAQKINIDKTREEKMMAIRKAAKGFFSHVRF
    SDTPSDMKKLSFKDIQGKEHTLSEFTGKPMLVNLWAIW
    CAPCRTEMPELAQLKHELGRENFDVIAINIDKTASPEKIQQF
    LQNIHADNLLYYRDETMDIFNNVRKQGLALGLPITFLIDKEGYLIASFNGAAPWANDDAKALIKAVIKEAL

    >gi|240851384|ref|YP_002972787.1| dihydrolipoamide dehydrogenase [Bartonella grahamii as4aup]
    MSYDVAVIGAGPGGYVAAIKAAQLGLKVAIIEKRTTLGGTCLNVGCIPSKALLHASEVFSETQHGFETLGISIGKSKLNL
    EQMMVHKKAVVTANTSGVSFLMKKNKVDTFLGTAKILSAGHVEVVARDGNKQTIETKNIIIATGSESSGIPGVNVEIDEK
    TIVSSTGALSLEKVPEHMIVVGAGVIGSELGSVWSRLGAKVTIIEYLNKILGSMDGEVSRQFQKLMEKQGIEYKTGTKVT
    AVTQSGSTAQVTFEAVKGGAAETLEADVVLIATGRSPYTEGLGLGEAGVQLDERGFIAIDAHWQTNVPGIYAIGDVVKGP
    MLAHKAEEEGVAVAEILAGQKGHVNFDVIPSVVYTQPEIASVGRTEEELKTAGIEYNVGKFPFMANGRARAMQKSDGFVK
    ILSDKKTDRVLGGHILGFGAGEMIHEIAVLMEFGGSSEDLGRCCHAHPTLSEAVREAALATFAKPLHI