Zymomonas mobilis ZM4 uid58095

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|283856178|ref|YP_161805.2| glutaredoxin 2 [Zymomonas mobilis subsp. mobilis ZM4]
    MNLKLYIYEHCPFCVKARMIFGLKDLAFDQVILQHNDEAQPISMTGYKLVPILEEKGRFMGESMDIVQYIDQEKGRPLLT
    GARNPAVLRAMHSFSGIYSLLYPRAVMAPLPEFATQAARRYFIRRKEGEVGSFDQCIKETPRLIQRYEDSLEQLEPLIQS
    PEAVNGQLSTDDIHLFAQLRSLSLVKGVRYPDKVDRYRHRMADMTGIFLFDAIAR

    >gi|56551087|ref|YP_161926.1| DSBA oxidoreductase [Zymomonas mobilis subsp. mobilis ZM4]
    MSDMPQPTEEVRVENNSCHKKSCLCSALAGAVGGGVIVLGYLLSSHLISGKSGEPVRDYLMEHPEVIPQAMEALQQRETD
    KLVSQNRTALETPFAGAWDGAEKGRVTIVEFSDYA
    CGFCRKANGDLNRLLSEDKDIRLVIRQLPILGPDSEIAARTALAI
    AKNSSKFSEFHHQIYNSKHLSPEVIVDIVKSLGLNPQDIAKQGSDPAITQEITKNILLARELGLTGTPAFIIGDKVFSGV
    AGYDALKEAVAKIREKSSK

    >gi|283856233|ref|YP_162062.2| cystathionine beta-lyase [Zymomonas mobilis subsp. mobilis ZM4]
    MKLLVTPEWLYRNLANPRLHVIDAGSYPPDVDTKAYDEYCKAHIPGALFLDNHLLKDQNAPLPRMVPSLEKVEYEFGRLG
    LDPDDMIVIYDNLSLPSAARAWWLFMLHEYRHVMILDGGFARWKAERLPVESGAAIAPSPIILQLSRNEALIRTRNQVMH
    NIASGHEVVVDARAPKVFSGEAVANPALAPGHIPHSLNLPYEEMLDANGCWKTPTKIEKAFVSNRINLEQPLLFT
    CGAGR
    TAPALLFAARLLGKRDVSLYDGSWEEWGSDPDTPKETGPAFRESTRLITAGRRREWVRGKGGSVVNPPVWRASTILFDSV
    EDLREASSHPDDQLYYGRRGTPTQWALSEALTELHPGAEATMLYPSGVAALSMALLSALEAGDELLMVDSCYEPTRVFCD
    TVLKAQGINVTYYDPLIGQDIEQLFTPQTRAIFMESPGSLTFEVQDIPGICEVAHRYSITTILDNTWATPLFFPAIERGV
    DLSVMACTKYITGHSDTMMGSVTAIPSHIDKLKRISNLFGQYVSPDDANSALKGLRTLEVRLKAHEKNALKVAKWLSEQP
    EVAWVLHPALSSCPGHEFWHRDFKGSSGLFSFVLEGGDDRDRTALIDSLEHFGIGFSWGGYESLALPVDPQPIRTAASWQ
    AAGPVVRLHIGLEDPDDLIEDLAFGLKRFKASRDQSGF

    >gi|56551325|ref|YP_162164.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis subsp. mobilis ZM4]
    MAKTASVITLTPNAKMRIKKLLSEAPEGTVGVKLSTPKKGCSGLAYSLEYTDKADPLDERIVIDDAVLFIDNASLLYLIG
    SEMDWVEDDFQAAFQFKNPNATGMCGCGESFTV

    >gi|56551408|ref|YP_162247.1| dihydrolipoamide dehydrogenase [Zymomonas mobilis subsp. mobilis ZM4]
    MADHFDLIVLGGGPGGYVAAIRAAQLNLKVALVERVHLGGICLNWGCIPTKSLLRSAEVYHEMQNAEAYGLTSFKPDFDL
    DKIIARSREVATRLASGVKTLLRKNKVEVISGVGQLTGNQQMLVETTEGEEKILEAKDIIIATGARARQLPNVHSDGKHI
    WTYHHALKPPAMPKKLLVIGSGAIGIEFASFYADFGAEVSIVEHAPQILPMEDAEVSAYVAKAFKKRGIRILTQSALQNL
    TPDDEGVTAEIAGADGKVTKERFSHAIVAIGVVANVENIGLDKLGIKLDRGFIAVDGFGRTNVDHVWAIGDVAGAPCLAH
    KASHQGVIAAEAIAGCDHVHPLNTQNIPGCTYARPQVASVGLTEEKARQQGYNVKIGNFPFIANGKAIAQGATDGFVKTV
    FDADSGALLGAHMVGAEVTEMIQGYTVARTLETTEAEIMETIFPHPTLSEAMHESVLAAYGRALHF

    >gi|56551469|ref|YP_162308.1| glutaredoxin 2 [Zymomonas mobilis subsp. mobilis ZM4]
    MAFKLFIYEHCPFCVKARMIFGLKNIDFEKIVLLNDNETDPIRMIGKKMLPILEDDGRFIAESMDIVAHIDHLGTPIVTG
    RNSSKIANWLERVTPLFSSLIIPRIACAPFEDFATTAARAYFISKKEAQTGLFSRWLGESESLREEMNLLLEELAPLIDE
    SNAVNGELSTDDFHLFAFLRSLSIVKNVYYPVEVATYLQAMSKASKIGLLDQFAV

    >gi|56551589|ref|YP_162428.1| OsmC family protein [Zymomonas mobilis subsp. mobilis ZM4]
    MSVDAKYHATAIATGGRDGRSRTTDGSLDIKMTVPKELGGPGGEGNNPEQLFAAGYSACFLGAMKAVAPKLNLTVPKDAT
    VEATIGIGPRSEGGFGITADLSIHLPGFSKEDAKKLVETAHQV
    CPYSNATRNNVNVGLKIV

    >gi|56551649|ref|YP_162488.1| glutaredoxin 3 [Zymomonas mobilis subsp. mobilis ZM4]
    MAHIEIYTTRVCPYCKRAKALFAEKGVSFDEYDVTDDSAKRTEMIKRSGGRTVPQIFIDDKHIGGCDDLVKLNSEGKLDP
    LLAK

    >gi|56551811|ref|YP_162650.1| copper-translocating P-type ATPase [Zymomonas mobilis subsp. mobilis ZM4]
    MASKKTVSLFIKGMECAACSSRIEKRLNRLPDVEASVNFATEKAQVTFDPSVTQISDIIKIIEKIGYGAIESEKIDSEKQ
    RLLEQKLRKQTLYCFLLALFCSLPFLLQMVMMFFPNHSMAKTESEMPRLIQWGLATIVEFIAGASFFKAAWKSLRSGSAN
    MDVLVVLGTGMAYLYSSIVTFGGFRHLHIYFEASAMIITLVLLGRLLEDMAKNRAGSAMHSLLSLQPPIGHIEEDGHISD
    VVVSQIQAGNILVIRSGERVPVDGQIVAGESSFDEAMLTGEAMPVVKQAGDTVFAASINKGGAVRVKAIAVGAHTALAGI
    IRMVEEAQGSKAPIQKLADKIAGIFVPVVIVIAFLTLAVSWLLTGSFSSALVSAVSTLVIACPCSLGLAVPTAIMVGTGA
    GAKKGILIRNVDALERAKNINYLVVDKTGTITEGKPEVATVSCSAGIKEEDLLTVATSLASQSSHPLSQAIASFGRDKDI
    TIFLPDHILEKAGLGVTGTDKNHHKIRMGSFRFLEESGIKIQDSALSQLHQDEQKKESSFVYIARDNQYLGSIALADPVR
    PTSKKAVERLYDLGIEVAMLTGDNDITAQKIAENVGIRHYKAGLLPEDKANEIQSLKKQGHYVGMVGDGINDAPALAVAD
    VSFAIGAGSDIAIESADIILMKSNLEEVALAISLSRATMQKMKQNLFFAFIYNVLGIPLAAFGFLNPVIAGAAMAMSSVS
    VVSNSLLLSRWSAFPSGEIK

    >gi|56551894|ref|YP_162733.1| peptide methionine sulfoxide reductase [Zymomonas mobilis subsp. mobilis ZM4]
    MEKQAILAGGCFWCIEAIFKDIIGIISVESGYIGGDVPNPSYEQVCEGKTGHAEAVRLTFDPEKISYSDILDLFFDIHDP
    TQLNRQGDDIGVQYRSAIFPLDKAQEQVAQDAIVKAQAHSKKPIVTKIEPASIFYPAEAYHQDYFYQKGQENRYCSIVVA
    PKIAKFRKSHQDRIKKQASA

    >gi|56551993|ref|YP_162832.1| thioredoxin [Zymomonas mobilis subsp. mobilis ZM4]
    MSVINVTDASFEADVLKSPVPVVVDFWAEWCGPCRQIAPALGEIASELEGKMTLAKVEVDNNIETASRFGIRNIPTLLLF
    KNGEVVATRTGGAPKSQLKSWIESSL

    >gi|56552014|ref|YP_162853.1| glutathione S-transferase domain-containing protein [Zymomonas mobilis subsp. mobilis ZM4]
    MWQLYQFPLCPFSRKVRFLLGEKGIGYELIRESPWLKRDEFVDMNPAGQTPVMVDSSAPVILVDSQVICEFLEETVDRMP
    LISGTAVHRAEIRRLVSLFDNKLYFEVTAPLMNERMLKRLVHRQAPDAAILRGAMKNANSHLDYIDWLLDHRRWLAGPVL
    SLADFAAAAQISVSDYLGGVDWRGHENSREWYAAMKSRPSFQPILAERMEVILPPDHYDQPDF

    >gi|56552038|ref|YP_162877.1| thioredoxin reductase [Zymomonas mobilis subsp. mobilis ZM4]
    MSADPISTRVFILGSGPAGLTAAIYAARAGLNPIVAQGLQPGGQLTITTEVENFPGFREPIQGPWLMEEMQAQAENVGAK
    LVWDIITSVDFSQRPYRLMGDGGQVYLADSLIISTGAQARWLGLESETALRGKGISA
    CATCDGFFFRGKKVVVIGGGNTA
    VEEALYLTNHSPEVTLIHRRDSLRAEKIMQKRLLANPKIKIRWNSEVAEFIAGEDSALSAVKLKDTKTGEESLLETEGAF
    IAIGHKPATELFQGHLKLDDEGYIEVTPGTTQTSIKGIFACGDVMDKHYRQAVTAAGTGCMAALEAERFLGEIDFKED

    >gi|56552088|ref|YP_162927.1| UBA/THIF-type NAD/FAD binding protein [Zymomonas mobilis subsp. mobilis ZM4]
    MILTDNQLDRYARHIVLPEIGGKGQKKLLSAHVAIVGAGGIGSPVIQYLAAAGVGRLTIVDNDEVSLSNLQRQTLFATRD
    IGAHKVAMAANVVQRLNPDVKVLPYDQKLDAENAKKLIGQADIIVDGSDNFGTRLVVSDVATELKIPLVSAAVIRFEAQL
    AVFKGYEASKPCYRCFVGDDPGEPEMT
    CSSQGVLGALTGTIGSLAAIETIRLITRFGSESGDKLLLIDAKDFRFRTVSLS
    KDPNCRCKHSAE

    >gi|56552107|ref|YP_162946.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Zymomonas mobilis subsp. mobilis ZM4]
    MTDYDFDLFVIGAGSGGVRASRIAASHGASVAIAEEYRIGGTCVIRGCVPKKMLYYAADFAADLKKAQRFGWTLPEKKFD
    WATLRDVVLSDVTRLEGLYTQTLDNNHITHYKEHAVIDSANQIRLASGKKITARYILVAVGAEPAKLDILGAEYAVTSNE
    MFLLPSLPKRALVVGGGYIANEFAGILNSFGVETTIATHGDRILRGYDEEIAARLVEIGQGHGIDYRFNADIARIDKDSS
    GRLTTHFKDGSQIESDLVLFAIGRVAKSRDLGLDKADVKTNDRGAILVDEENRTSCPSIYAVGDVTDRVQLTPVAIREGQ
    AFADRVFGHKAASVDYDTIPTAVFSHPPLASAGLTEEEAKKRYKNIKIYKSNFRPMRNALIDSPDRALYKMVVDGDSDKV
    LGLHLIGQDSPEIIQLAAVAIKAGLTKQAFNDTVALHPSSAEELVLMR

    >gi|283856432|ref|YP_162989.2| redoxin domain-containing protein [Zymomonas mobilis subsp. mobilis ZM4]
    MKTWLKWLPFIGFAACFLFFRLALSHPENTVVPSKQIGKALPEFQLPAVLPDIAGVNSREMKNGQPHFLNIFASWCLPCA
    EESGSLMAIHEAGIPIMAIAIRDKPADITRFLNRYGNPYQAIGIDQGSQIQLAIGSSGVPESFLVDGQGVIRYQHIGAVT
    EKDLPQLMSIWRQITA

    >gi|56552285|ref|YP_163124.1| cytochrome c biogenesis protein transmembrane region [Zymomonas mobilis subsp. mobilis ZM4]
    MTILASVYRAFGCLFCWALALFIYPLSAATLSDSDLHIEPQFIAETLTPKAGTKVTVALEMKPHQGWHGYWKNGGDAGQE
    TEIIWHFPYKIKTSAIQYPIPEKMKVAGLMSYVYQHDYRLLIDLDIPAGLPVGTALPISAQLNWLACTDTSCVPETAERH
    LLLHIGKGEITADNSQLFQAFRRALPETTGRQALFAQQQNQIILKLDYPEAEKLDSTINGVWFFPSQDGVFDYSADQRLL
    REGNALFLILPFREKASIPSAITGVLRLKDGKGFLVNAQKGNISLPDKNPVILTASSEEGQAKATASPQQNTAQNAPPSV
    GKGHNGKLLWLALAGAFLGGLILNIMPCVFPILSLKALSLARTHAPEKAHRLEASAYSAGVIMVCLGLGAALLLFRAGGH
    AVGWAFQLQYPHIVLALMVLTAMIGFNLAGLFELPSFNGGANPKQDSLLGAFTTGALAAFIATPCTGPFMAAAIGVALVL
    SPIESLMVFAGLGIGMALPFLAIGFVPPIRKLLPRPGAWMATMRHILAIPMFITALWLGWTLGHQIGTDGLIVAFGICLI
    SATGLWWTGKRQHKGKNYSFLPAAIAILFSVVIGSFTPAHPIASETNPKVENAKDAPEIEPFSEQAVEELHRQKKPLFIY
    FSADW
    CLTCKVNEKMAIDRDSTRQAFRQKGIVTLHGDWTNGDPEITHFLSKMHRSGIPLYLYYPADGEIQILPQILTTGL
    LQNLGK

    >gi|56552298|ref|YP_163137.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis subsp. mobilis ZM4]
    MTNNPTDKAAIIFSPEAAERVAEIAHQQKKPAILRLSVEGGGCSGFRYQYNLADKPEADDYQAPQGDSLLIIDPVSFDLL
    AGATVNFVKSINGAAFQIDNPNAVSGCGCGSSFSV

    >gi|56552356|ref|YP_163195.1| 3-mercaptopyruvate sulfurtransferase [Zymomonas mobilis subsp. mobilis ZM4]
    MTDHISPLISVSQLYDLLKNAPEKLRLFDVTVNLPSPRFDGDYRLSDDAKGWQSKHIPQARYCNILDEKIADHSAPYSFA
    PTDNQTLIKGLEEIGVDSNASIVLYDRGSGFWAARLWWVLKSIGVEAKVLDGGFSAWVQAGYPIESGNIENFSKGHIIYD
    IQKNMWSSLAEVKNIVENNSNNLLICALSEDVFKGKSPTRYTRRGHIPKSICIPARSMHDSQGRFLPVSELKKKIDPLFK
    KNRSIVLY
    CGGGISAASLALAFAICGRDVSIYDGSLQEWTAQLHLPIVTEDI

    >gi|56552571|ref|YP_163410.1| protein-disulfide isomerase-like protein [Zymomonas mobilis subsp. mobilis ZM4]
    MMKKLKIGLGAVLLLAGSSFMVSACHKTEKAPANSQQEAALPAAIPAPNGSSWTDVVSVSPEGGFVMGNPKAPVSLVEYA
    SFT
    CPHCADFTQEGFPKLRDNYIAKGLVKLEFRNLVRDPFDIALTLLARCRGAETFFPIADQLFQEQKPMFERIQNADKA
    DLQRVAGLPQDQQMAEYIRLTGMNPFFGNRGLPTSAQNKCLTDQAAIKTLMDIRSIADKQNVTGTPMFLINGTLQEVGIG
    SPIWDQLEPALKAALQ

    >gi|56552601|ref|YP_163440.1| thioredoxin domain-containing protein [Zymomonas mobilis subsp. mobilis ZM4]
    MSTLGLSSADQKAIENFRQQAVEPSETKLVLLYFSATWSNACKSFGAMLANIAKSYASKGVVVTSFDIDQNKIIADQLRV
    QSVPTLYALFQGQLVADLTPANGEAQLKQALDQLLTQLPIAAEAAGEEDIEQILEAGNKALDNNDAEQAVTLLGQAYDLK
    PEEAAVAGAYARALILAGDIKKAEALLSALPEDMKDKPEIHRAEAALSLAKQADSVNLDQLENLRAKVENYPDDDEARFA
    LACDLIAVGNRDGAADQLLAILAHNRDWNEGAARTKLLQLFEVVGIEDPWVSAQRRRLSAILFR

    >gi|56552628|ref|YP_163467.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Zymomonas mobilis subsp. mobilis ZM4]
    MLTVGDKFPALKLPVQQGVSALPNGETIDLGETNGKWKVVFFWPMDFTFVCPTEIVGYNDIKEDLSLRDAVLIGGSCDTA
    FVHYAWRKSDERLENADFPWIADNSKKLASALGIVNEEAGVAYRATFIVDPNNVIQHVTVNSLNVGRNPAEALRVLDALQ
    TDDLCPCNWHKGEEVLDPKA

    >gi|56552705|ref|YP_163544.1| electron transport complex RsxE subunit [Zymomonas mobilis subsp. mobilis ZM4]
    MSNNEYFRIAKDGLWDNNGILSMLLGLCPTMAVTTSATNALGMGLATAAVMAASNLLVSVFRHHITYEVRVPVYILIVAA
    MVTLVDLVMNAYMHPLYKVLGLFIPLIVSN
    CLPLAHLEAFAGKKPPLASLTDGVFAGLGFTFALTIIGGLREIIGSGTLF
    ANAALLLGSSFRFLECHLLPTDCHILMMVLPPGGFLVTGFVLVGKRMIDVAQGKEISMSGAHGA

    >gi|56552710|ref|YP_163549.1| RnfABCDGE type electron transport complex subunit A [Zymomonas mobilis subsp. mobilis ZM4]
    MTDILLLVVSACLVNNVILTRFLGLCSFMGVTTRVDTAVGMGAACTFVITTSSMASWALEHWLLAPFGLGYLRTVTFILI
    IASAVQLTESFFRKFSPTLFRLLGIYLPLITTN
    CAVLGITLLLVEQHYGFVDSTVFAFASSVGYSLVMVLFAGLRERLAL
    SVTPRLFEGPPIGFVTASLLALAFMGFSGMSVH

    >gi|56552728|ref|YP_163567.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis subsp. mobilis ZM4]
    MLHLTDSASDAIRKSITGTEDASVYAIRIMVETGGCAGLIYRMALARKAEVDDIIVEEKGVKIFVEAESAPLLEGTKIDF
    VTDLEESGFTFDNPNAGSKCSCGKSFH

    >gi|56552769|ref|YP_163608.1| glutaredoxin-like protein [Zymomonas mobilis subsp. mobilis ZM4]
    MADTINDRIKEVLEKSPVVLFMKGTPLFPQCGFSNQIVSILNAVGIEYDSVDVLQDPEIRQGIKVYSDWPTFPQLYVKGE
    LVGGCDIVTEMYQSGELAELMQKENIARKN

    >gi|56552885|ref|YP_163724.1| methylated-DNA/protein-cysteine methyltransferase [Zymomonas mobilis subsp. mobilis ZM4]
    MMPQLYYPTIIGLFSLQASDQYLERVAIMPPAMKKPEKQDLAAILKQSPLLKEVVAQIEAYFTGKVFSFDLPLQPAKTAR
    GEAIRQALCQIPYGETASYRQLAIKAESGARAIGQACARNPLALIVP
    CHRIIKADGSLGQYSAGEGITTKAWLIDHERLH
    RGSFSL