Zymomonas mobilis NCIMB 11163

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|260752329|ref|YP_003225222.1| Redoxin domain protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MKTWLKWLPFIGFAACFLFFRLALSHPENTVVPSKQIGKALPEFQLPAVLPDIAGVNSREMKNGQPHFLNIFASWCLPCA
    EESGSLMAIHEAGIPIMAIAIRDKPADITRFLNRYGNPYQAIGIDQGSQIQLAIGSSGVPESFLVDGQGVIRYQHIGAVT
    EKDLPQLMSIWRQITA

    >gi|260752367|ref|YP_003225260.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MTDYDFDLFVIGAGSGGVRASRIAASHGASVAIAEEYRIGGTCVIRGCVPKKMLYYAADFAADLKKAQRFGWTLPEKKFD
    WSTLRDVVLSDVTRLEGLYTQTLDNNHITHYKEHAVIEGANQIRLASGKKITARYILVAVGAEPAKLDIPGAEYAVTSNE
    MFLLPSLPKRALVVGGGYIANEFAGILNSFGVETTIATHGDRILRGYDEEIAARLVEIGQGHGIDYRFNADIARIDKDSS
    GHLTTHFKDGSQIESDLVLFAIGRVAKSRDLGLDKADVKTNDRGAILVDEENRTSCPSIYAVGDVTDRVQLTPVAIREGQ
    AFADRVFGHKAASVDYDTIPTAVFSHPPLASAGLTEEEAKKRYKNIKIYKSNFRPMRNALIDSPDRALYKMVVEGDSDKV
    LGLHLIGQDSPEIIQLAAVAIKAGLTKQAFNDTVALHPSSAEELVLMR

    >gi|260752382|ref|YP_003225275.1| UBA/THIF-type NAD/FAD binding protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MILTDNQLDRYARHIVLPEIGGKGQKKLLSAHVAIVGAGGIGSPVIQYLAAAGVGRLTIVDNDEVSLSNLQRQTLFATRD
    IGAHKVAMAANVVQRLNPDVKVLPYDQKLDAENAKKLIGQADIIVDGSDNFGTRLVVSDVATELKIPLVSAAVIRFEAQL
    AVFKGYEASKPCYRCFVGDDPGEPEMT
    CSSQGVLGALTGTIGSLAAIETIRLITGFGSESGDKLLLIDAKDFRFRTVSLS
    KDPNCRCKHSAE

    >gi|260752428|ref|YP_003225321.1| thioredoxin reductase [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MSADPISTRVFILGSGPAGLTAAIYAARAGLNPIVAQGLQPGGQLTITTEVENFPGFREPIQGPWLMEEMQAQAENVGAK
    LVWDIITSVDFSQRPYRLTGDGGQVYLADSLIISTGAQARWLGLESETALRGKGISA
    CATCDGFFFRGKKVVVIGGGNTA
    VEEALYLTNHSPEVTLIHRRDSLRAEKIMQKRLLANPKIKIRWNSEVAEFIAGEDSALSAVKLKDTKTGEESLLETEGAF
    IAIGHKPATELFQGHLKLDDEGYIEVTPGTTQTSIKGIFACGDVMDKHYRQAVTAAGTGCMAALEAERFLGEIDFKED

    >gi|260752448|ref|YP_003225341.1| Glutathione S-transferase domain protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MWQLYQFPLCPFSRKVRFLLGEKGIGYELIRESPWLKRDEFVDMNPAGQTPVMVDSSAPVILVDSQVICEFLEETVDRMP
    LISGTAVHRAEIRRLVSLFDNKLYFEVTAPLMNERMLKRLVHRQAPDAAILRGAMKNANSHLDYIDWLLDHRRWLAGPVL
    SLADFAAAAQISVSDYLGGVDWRGHENSREWYAAMKSRPSFQPILAERMEVILPPDHYDQPDF

    >gi|260752464|ref|YP_003225357.1| thioredoxin [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MSVINVTDASFEADVLKSPVPVVVDFWAEWCGPCRQIAPALGEIASELEGKMTLAKVEVDNNIETASRFGIRNIPTLLLF
    KNGEVVATRTGGAPKSQLKSWIESSL

    >gi|260752550|ref|YP_003225443.1| peptide methionine sulfoxide reductase [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MEKQAILAGGCFWCIEAIFKDIIGIISVESGYIGGDVPNPSYEQVCEGKTGHAEAVRLTFDPEKISYSDILDLFFDIHDP
    TQLNRQGDDIGVQYRSAIFPLDKAQEQVAQDAIVKAQAHSKKPIVTKIEPASIFYPAEAYHQDYFYQKGQENRYCSIVVA
    PKIAKFRKSHQDRIKKQASA

    >gi|260752625|ref|YP_003225518.1| copper-translocating P-type ATPase [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MASKKTVSLFIKGMECAACSSRIEKRLNRLPDVEASVNFATEKAQVTFDPSVTQISDIIKIIEKIGYGAIESEKIDSEKQ
    RLLEQKLRKQTLYCFLLALFCSLPFLLQMVMMFFPNHSMAKTESEMPRLIQWGLATIVEFIAGASFFKAAWKSLRSGSAN
    MDVLVVLGTGMAYLYSSIVTFGGFRHLHIYFEASAMIITLVLLGRLLEDMAKNRAGSAMHSLLSLQPPIGHIEEDGHISD
    VVVSQIQAGNILVIRSGERVPVDGQIVAGESSFDEAMLTGEAMPVVKQAGDTVFAASINKGGAVRIKAIAVGAHTALAGI
    IRMVEEAQGSKAPIQKLADKIAGIFVPVVIVIAFLTLAVSWLLTESFSSALVSAVSTLVIACPCSLGLAVPTAIMVGTGA
    GAKKGILIRNVDALERAKNINYLVVDKTGTITEGKPEVATVSCSAGIKEEDLLTVATSLASQSSHPLSQAIASFGRDKDI
    TIFLPDHILEKAGLGVTGTDKNHHKIRMGSLRFLEESGIKIQDSALSQLHQDEHKKESSFVYIARDNQYLGSIALADPVR
    PTSKKAVERLYDLGIEVAMLTGDNDITAQKIAENVGIRHYKAGLLPEDKANEIQSLKKQGHYVGMVGDGINDAPALAVAD
    VSFAIGAGSDIAIESADIILMKSNLEEVALAISLSRATMQKMKQNLFFAFIYNVLGIPLAAFGFLNPVIAGAAMAMSSVS
    VVSNSLLLSRWSAFPSGEIK

    >gi|260752763|ref|YP_003225656.1| glutaredoxin 3 [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MAHIEIYTTRVCPYCKRAKALFAEKGVSFDEYDVTDDSAKRTEMIKRSGGRTVPQIFIDDKHIGGCDDLVKLNSEGKLDP
    LLAK

    >gi|260752814|ref|YP_003225707.1| OsmC family protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MSVDAKYHATAIATGGRDGRSRTTDGSLDIKMTVPKELGGPGGEGNNPEQLFAAGYSACFLGAMKAVAPKLNLTVPKDAT
    VEATIGIGPRSEGGFGITADLSIHLPGFSKEDAKKLVETAHQV
    CPYSNATRNNVNVGLKIV

    >gi|260752919|ref|YP_003225812.1| glutaredoxin, GrxB family [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MAFKLFIYEHCPFCVKARMIFGLKNIDFEKIVLLNDNETDPIRMIGKKMLPILEDDGRFIAESMDIVAHIDHLGTPIVTG
    RNSSKIANWLERVTPLFSSLIIPRIACAPFEDFATTAARAYFISKKEAQTGLFSRWLGESESLREEMNLLLEELAPLIDE
    SNAVNGELSTDDFHLFAFLRSLSIVKNVYYPVEVATYLQAMSKASKIGLLDQFAV

    >gi|260752981|ref|YP_003225874.1| dihydrolipoamide dehydrogenase [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MADHFDLIVLGGGPGGYVAAIRAAQLNLKVALVERVHLGGICLNWGCIPTKSLLRSAEVYHEMQNAEAYGLTSFKPDFDL
    DKIIARSREVATRLASGVKTLLRKNKVEVISGVGQLTGNQQMLVETTEGEEKILEAKDIIIATGARARQLPNVHSDGKHI
    WTYHHALKPPAMPKKLLVIGSGAIGIEFASFYADFGAEVSIVEHAPQILPMEDAEVSAYVAKAFKKRGIRILTQSALQNL
    TPDDEGVTAEIAGADGKVTKERFSHAIVAIGVVANVENIGLDKLGIKLDRGFIAVDGFGRTNVDHVWAIGDVAGAPCLAH
    KASHQGVIAAEAIAGCDHVHPLNTQNIPGCTYARPQVASVGLTEEKARQQGYNVKIGNFPFIANGKAIAQGATDGFVKTV
    FDADSGALLGAHMVGAEVTEMIQGYTVARTLETTEAEIMETIFPHPTLSEAMHESVLAAYGRALHF

    >gi|260753056|ref|YP_003225949.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MAKTASVITLTPNAKMRIKKLLSEAPEGTVGVKLSTPKKGCSGLAYSLEYTDKADPLDERIVIDDAVLFIDNASLLYLIG
    SEMDWVEDDFQAAFQFKNPNATGMCGCGESFTV

    >gi|260753142|ref|YP_003226035.1| cystathionine beta-lyase [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MKLLVTPEWLYRNLANPRLHVIDAGSYPPDVDTKAYDEYCKAHIPGALFLDNHLLKDQNAPLPRMVPSLEKVEYEFGRLG
    LDPDDMIVIYDNLSLPSAARAWWLFMLHEYRHVMILDGGFARWKAERLPIESGAAIAPSPIILQLSRNEALIRTRNQVMH
    NIASGHEVVVDARAPKVFSGEAVANPALAPGHIPHSLNLPYEEMLDANGCWKTPTKIEKAFVSNRINLEQPLLFT
    CGAGR
    TAPALLFAARLLGKRDVSLYDGSWEEWGSDPDTPKETGPAFRESTRLITAGRRREWVRGKGGSVVNPPVWRASTILFDSV
    EDLREASSHPDDQLYYGRRGTPTQWALSEALTELHPGAEATMLYPSGVAALSMALLSALEAGDELLMVDSCYEPTRVFCD
    TVLKAQGINVTYYDPLIGQDIEQLFTPQTRAIFMESPGSLTFEVQDIPGICEVAHRYSITTILDNTWATPLFFPAIERGI
    DLSVMACTKYITGHSDTMMGSVTAIPSHIDKLKRISNLFGQYVSPDDANSALKGLRTLEVRLKAHEKNALKVAKWLSEQP
    EVAWVLHPALSSCPGHEFWHRDFKGSSGLFSFVLEGGDDRDRTALIDSLEHFGIGFSWGGYESLALPVDPQPIRTAASWQ
    AAGPVVRLHIGLEDPDDLIEDLAFGLKRFKASRDQSGF

    >gi|260753256|ref|YP_003226149.1| DSBA oxidoreductase [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MPDMPQPTEEVRVENNSCHKKSCLCSALAGAVGGGVVVLGYLLSSHLISGKSGEPVRDYLMEHPEVIPQAMEALQQRETD
    KLVSQNRTALETPFAGAWDGAEKGRVTIVEFSDYA
    CGFCRKANGDLNRLLSEDKDIRLVIRQLPILGPDSEIAARTALAI
    AKNSSKFSEFHHQIYNSKHLSPEVIVDIVKSLGLNPQDIAKQGSDPAITQEITKNILLARELGLTGTPAFIIGDKVFSGV
    AGYDALKEAVAKIREKSSK

    >gi|260753358|ref|YP_003226251.1| glutaredoxin, GrxB family [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MNLKLYIYEHCPFCVKARMIFGLKDLAFDQVILQHNDEAQPISMTGYKLVPILEENGHFMGESMDIVQYIDQEKGRPLLT
    GARNPAVLRAMHSFSGIYSLLYPRAVMAPLPEFATQAARRYFIHRKEGEVGSFDQCIKETPRLIQRYEDSLEQLELLIQS
    PEAVNGQLSTDDIHLFAQLRSLSLVKGVRYPDKVDRYRHRMADMTGIFLFDAIAR

    >gi|260753418|ref|YP_003226311.1| methylated-DNA/protein-cysteine methyltransferase [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MMPQLYYPTIIGLFSLQASDQYLERVAIMPPAMKKPEKQDLAAILKQSPLLKEVVAQIEAYFTGKVFSFDLPLQPAKTAR
    GEAIRQALCQIPYGETASYRQLAIKAESGARAIGQACARNPLALIVP
    CHRIIKADGSLGQYSAGEGITTKAWLIDHERLH
    RGSFSL

    >gi|260753501|ref|YP_003226394.1| glutaredoxin-like protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MADTINARIKEILEKSPVVLFMKGTPLFPQCGFSNQIVSILNAVGIEYDSVDVLQDPEIRQGIKVYSDWPTFPQLYVKGE
    LVGGCDIVTEMYQSGELAELMQKENIARKN

    >gi|260753633|ref|YP_003226526.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MLHLTDSASDAIRKSITGTEDASVHAIRIMVETGGCAGLIYRMALARKAEVDDIIVEEKGIKIFVEAESAPLLEGTKIDF
    VTDLEESGFTFDNPNAGSKCSCGKSFH

    >gi|260753650|ref|YP_003226543.1| electron transport complex, RnfABCDGE type, A subunit [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MTDILLLVVSACLVNNVILTRFLGLCSFMGVTTRVDTAVGMGAACTFVITTSSMASWALEHWLLAPFGLGYLRTVTFILI
    IASAVQLTESFFRKFSPTLFRLLGIYLPLITTN
    CAVLGITLLLVEQHYGFVDSTVFAFASSVGYSLVMVLFAGLRERLAL
    SVTPRLFEGPPIGFVTASLLALAFMGFSGMSVH

    >gi|260753655|ref|YP_003226548.1| electron transport complex, RnfABCDGE type, E subunit [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MSNNEYFRIAKDGLWDNNGILSMLLGLCPTMAVTTSATNALGMGLATAAVMAASNLLVSVFRHHITYEVRVPVYILIVAA
    MVTLVDLVMNAYMHPLYKVLGLFIPLIVSN
    CLPLAHLEAFAGKKPPLASLTDGVFAGLGFTFALTIIGGLREIIGSGTLF
    ANAALLLGSSFRFLECHLLPTDCHILMMVLPPGGFLVTGFVLVGKRMIDVAQGKEISMSGAHGA

    >gi|260753718|ref|YP_003226611.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MLTVGDKFPALKLPVQQGVSALPNGETIDLGETNGKWKVVFFWPMDFTFVCPTEIVGYNDIKEDLSLRDAVLIGGSCDTA
    FVHYAWRKSDERLENADFPWIADNSKKLASALGIVNEEAGVAYRATFIVDPNNVIQHVTVNSLNVGRNPAEALRVLDALQ
    TDDLCPCNWHKGEEVLDPKA

    >gi|260753743|ref|YP_003226636.1| Thioredoxin domain protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MSTLGLSSADQKAIENFRQQAVEPSETKLVLLYFSATWSNACKSFGAMLANIAKSYASKGVVVTSFDIDQNKIIADQLRV
    QSVPTLYALFQGQLVADLTPANGEAQLKQALDQLLTQLPIAAEAAGEEDIEQILEAGNKALDNNDAEQAVTLLGQAYDLK
    PEEAAVAGAYARALILAGDIKKAEALLSALPEDMKDKPEIHRAEAALSLAKQADSVNLDQLENLRAKVENYPDDDEARFA
    LACDLIAVGNRDGAADQLLAILAHNRDWNEGAARTKLLQLFEVVGIEDPWVSAQRRRLSAILFR

    >gi|260753773|ref|YP_003226666.1| Protein-disulfide isomerase-like protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MMKKLKIGLGAVLLLAGSSFMVSACHKTEKAPANSQQEAALPAAIPAPNGGSWTDVVSVSPEGGFVMGNPKAPVSLVEYA
    SFT
    CPHCADFTQEGFPKLRDNYIAKGLVKLEFRNLVRDPFDIALTLLARCRGAETFFPIADQLFQEQKPMFERIQNADKA
    DLQRVAGLPQDQQMAEYIRLTGMNPFFGNRGLPTSAQNKCLTDQAAIKILMDIRSIADKQNVTGTPMFLINGTLQEVGIG
    SPIWDQLEPALKAALQ

    >gi|260753957|ref|YP_003226850.1| Rhodanese domain protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MTDHISPLISVSQLYDLLKNAPEKLRLFDVTVNLPSPRFDGDYRLSDDAKGWQSKHIPQARYCNILDEKIADHSAPYSFA
    PTDNQTLIKGLEEIGVDSNASIVLYDRGSGFWAARLWWVLKSIGVEAKVLDGGFSAWVQAGYPIESGNIENFSKGHIIYD
    IQKNMWSSLAEVKNIVENNSNNLLICALSEDVFKGKSPTRYTRRGHIPKSICIPARSMHDSQGRFLPVSELKKKIDPLFK
    KNRSIVLY
    CGGGISAASLALAFAICGRDVSIYDGSLQEWTAQLHLPIVTEDI

    >gi|260754010|ref|YP_003226903.1| iron-sulfur cluster assembly accessory protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MTNNPTDKAAIIFSPEAAKRVAEIAHQQKKPAILRLSVEGGGCSGFRYQYNLADKPEADDYQAPQGDSLLIVDPVSFDLL
    AGATVNFVKSINGAAFQIDNPNAVSGCGCGSSFSI

    >gi|260754022|ref|YP_003226915.1| cytochrome c biogenesis protein transmembrane region [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MTILASVYRAFGCLFCWALALFIYPLSAATLSDSDLHIEPQFIAETLTPKAGTKVTVALEMKPHQGWHGYWKNGGDAGQE
    TEIIWRFPYKIKTSAIQYPIPEKMKVAGLMSYVYQHDYRLLIDLDIPAGLPVGTALPISAQLNWLACTDTSCVPETAERH
    LLLHIGKGEITADNSQLFQAFRRALPETTGRQALFAQQQNQIILKLDYPETEKLDSTINGVWFFPSQDGVFDYSADQRLL
    REGNALFLTLPLREKASIPSAITGVLRLKDGKGFLVNAQKGNISLPDKNPVILTASSEEGQAKTTTSPQQNTAQNAPPSV
    GKGHNGKLLWLALAGAFLGGLILNIMPCVFPILSLKALSLARTHAPEKAHRLEASAYSAGVIMVCLGLGAALLLFRAGGH
    AVGWAFQLQYPHIVLALMVLTAMIGFNLAGLFELPSFNGGANPKQDSLLGAFTTGALAAFIATPCTGPFMAAAIGVALVL
    SPIESLMVFAGLGIGMALPFLAIGFVPPIRKLLPRPGAWMATMRHILAIPMFITALWLGWTLGHQIGTDGLIVAFGICLI
    SATGLWWTGKRQHKGKNYSFLPAAIAILFSVVIGSFTPAHPIASETNPKVENAKDAPEIEPFSEQAVEELHRQKKPLFIY
    FSADW
    CLTCKVNEKMAIDRDSTRQAFRQKGIVTLHGDWTNGDPEITRFLSKMHRSGIPLYLYYPADGEIQILPQILTTGL
    LQNLGK

    >gi|260712921|ref|YP_003226976.1| arsenate reductase [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MSNITIYHNPACGTSRNTLEMIRNSGIEPTVILYLETPPSRDELLKLIADMGISVRALLRKNVEPYEELGLAEDKFTDDQ
    LIDFMLQHPILINRPIVVTPLGTKLCRPSEVVLDILPDAQKAAFTKEDGEKVVDDSGKRLK

    >gi|260752624|ref|YP_003225517.1| Heavy metal transport/detoxification protein [Zymomonas mobilis subsp. mobilis NCIB 11163]
    MTRVIFQVEGMHCEKCVKTIEGHLGQLQGVSAVTASLKNKAVTINYNPDEVSEDVLRKEIDDLGYDIVA