Bacteroides vulgatus ATCC 8482 uid58253

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150002676|ref|YP_001297420.1| hypothetical protein BVU_0068 [Bacteroides vulgatus ATCC 8482]
    MRYLCLLLCVFALFSSCKESEKDKIARLVEEWEGKEILFPAHSFFTIQGKDTVDFSLADADYKVVTYIDSVGCTSCKLQL
    LRWKLFMQEVDSTLNRPVPFVFYFHPKDMKELRYITRRDAFVYPVCFDEKDDFNRLNHFPDEMTFQTFLLDKDNRVAAIG
    NPVHNPKVKELYLKVLTGGEVVKAETPITKVSLDVTSIDFGSFPQSEKQERKFTLTNTGQHVLVIYDVITS
    CGCTKVNYN
    KEGVRPGEKAELTVIYEAEKAEHFSKTVTIYCNADNSPLRLKVTGNAE

    >gi|150002718|ref|YP_001297462.1| putative thiol:disulfide interchange protein DsbE [Bacteroides vulgatus ATCC 8482]
    MKNFGILLLAMVSCCLLQAKDRVVKQPPFIARSSSTIEIDRVVVSDTATVLDVKAFFRPHNWIQISNESYLLADNGEKYP
    IRSGNGITLGEKFWMPDSGEASFSLIFPLLPPTVKVIDFIESDCEDCFKVWGIHLDGKLPELDLSDDVKKQKLNYAEPLP
    KAELKDGKSVITGRLLDYEKHYALPFSCRTCDLLTAKFEDTEIKVNEDGTFRTEIELCAPTTVSFSVGRDIYFDVFLVPG
    GELDMAVNLRELSRSESKLLKGKRAGGKKVYFSGTMAALNDEMITDDEHLMDVWGMVHWNMNDLYNMTAGQYKAYWLKKY
    EETKSAICSDKKRSQAYRELLLAQNDLLCTLTLTRVSSNLAYAYVQCSGLPAREAYQKFKQPELSDDFYDYIRQLNILNS
    PVMLYANGYADLVRGMGYLRVKMDDELSDIFAFILSSDKVSAEDAKIIREFKADTDTGKTSVYQEKMGELRIKYDELFKE
    FSSMQQDYILKKIIAGYLGTDQGLFFDLQKMMKYAQKISDFTPLTVHDFEEIRKMSDPYYLGRLTKMNNRLLETIDANKK
    KKGYTVNESGEVKDEDLFYSIISKFKGKVILVDFWATW
    CGPCKMAMKQMKPMKKDLEGKDIVYVFIAGENSPKETWDNMI
    PDIHGEHYRVTAAQWKYLSKQFSIQGVPTYIIVDKEGAVIQKHTGFPGVDTVKKELMKALEK

    >gi|150002719|ref|YP_001297463.1| putative thiol:disulfide interchange protein [Bacteroides vulgatus ATCC 8482]
    MKKILALALFAVALVSCRQTMQTDGFKLSGHLEGLQVGDTLFLKTFLLPDWKEDGTDTILVEKEGIFSAFIPMEHTTFYL
    LTHQPKVGEPLRSCIRGAEIIARVGDDIKLEGSLDYLGAVRHSGGFYDNSLVARYDSLTASSNTEMIDIFSQILKYQDTK
    QNDSVAKYGQMYNEYHRPLMLKTVRDSLALKVNDMEYAAFMYASAFVFDATYKDVKERLAQFTPEIQNSYFGQILDKQLL
    VLKNIEVGFAPAEFTVTDKDGRKVFLSDYKGKYVLIYHWGL
    CPGTFWVNPKITDLYQKYHEKGLEVLGFTRDDLLKSLQG
    SSEEFKKDERVQGLLSHPWTTVYTEDEGNGFIVKDLYFSGVPILMLISPDGITLARGYTKAYEEVKNLLDRNLGNK

    >gi|150003005|ref|YP_001297749.1| putative protein disulfide isomerase [Bacteroides vulgatus ATCC 8482]
    MKMKKLGLLFMMLCMVFAVNAQELKKGDKLPDFHLKSAVYGDVSSAELKGKVVLVSLFATWCGPCQLELAEIEKTLWPEY
    KDNKDFVLLVIGREHTDEQLRAYNERKKFTFPLYPDPKREVFSLFAEKSIPRAYLFNKEGEAVYTSIGYEKEEFGYLMNA
    IAEALK

    >gi|150003138|ref|YP_001297882.1| hypothetical protein BVU_0550 [Bacteroides vulgatus ATCC 8482]
    MIKTIYFVFFICAFSLGLWACTGKDSDKFKNLSSDQFEEMIQDKTIQLVDVRTVAEYSEGHIPGSININVLDNEFGTNIE
    ELLQKDRPVAVY
    CKSGRRSRNAANILVKKGFKVYNLDKGILDWKELGKEISF

    >gi|150003348|ref|YP_001298092.1| hypothetical protein BVU_0766 [Bacteroides vulgatus ATCC 8482]
    MKKKNYSIILCGGLFLASCMSNNDKCLQKLFDEVGVEKSQIHNATHLVTILGNGCKGCIHKALSEIHNSTDTIYIIACKS
    KKTFNLIANKNIDDYSNVYLDTKSILVELDMAKNTPRVYLLNNGKYVSHSFYGNESPSKEANTTITFNTNEIDLGKISRT
    EKARIKFTIWNTGKNIVRISHIDLS
    CECLNIENEITEINPGDSTCLNIIFHPDDIGKFQREILLYGNFDSSPKLLTITGE
    CF

    >gi|150003421|ref|YP_001298165.1| alkyl hydroperoxide reductase subunit F [Bacteroides vulgatus ATCC 8482]
    MLDSAIKDQLKGLFAQLEAHYTFDIFVHPQHESRAELVDLLEEVASCSDKLSCRLQDSEGLKFILLKEGKDTGITFRAVP
    GGHEFTSLLMAVLNADGKGKNFPDEFITRRIKALQGAISLTTYLSLT
    CTNCPDVVQALNMMVLLNGQIRHEAVDGSINEE
    EVERMKVQAVPTVFADGEQIHVGRSSMGDLLEKLEARYGSVELEAVETKEYDVLVAGAGPAGATAAIYSARKGLKVAIIA
    ERIGGQVNETMGIENLISVHQTTGKQLAQDLKKHLAEYHIDILENRRIEKVEVAEGMKVLSVKGGETYKAPVLIIATGAN
    WRKLNVPGEEKYIGHGVAF
    CPHCDGPFYKNKEVAVIGGGNSGVEAAIDLAGVCSKVTVFEFMDTLKADTVLQEKAKSLPN
    VDIITNTQTVEVLGNGDKVVGLIKKDRSSEKEEIFALDGIFVQIGLTANSTLFKELLETNRMGEILTDKNGRTSVKGIYA
    AGDVTDVSYKQIVIAMGEGAKAALAAFEDRMRGTIY

    >gi|150003422|ref|YP_001298166.1| alkyl hydroperoxide reductase subunit C [Bacteroides vulgatus ATCC 8482]
    MEPIINSQVPEFKVQAFHNGEFKTVTNKDIEGKWAIFFFYPADFTFVCPTELVDIAEKYNQFKAMGVEVYSVSTDSHFVH
    KAWHDASESIRKITYPMLADPTGALSRAFGVMIEEDGMAYRGTFVVNPEGKIKLAEIQDNSIGRNADELLRKVEAAQFVA
    THDGEVCPAKWKKGAETLKPSIDLVGKI

    >gi|150003678|ref|YP_001298422.1| dihydrolipoamide dehydrogenase [Bacteroides vulgatus ATCC 8482]
    MKYQIAIIGGGPAGYTAAEAAGKAGLSVVLFEKRSLGGVCLNEGCIPTKTLLYSAKVYDYAKHASKYAVNVPEASFDLGK
    IVARKSKVVRKLVLGIKAKLTAHQVHIVTGEATIVDKNTIQCGGETYECENLLLCTGSETFIPPIPGVENVDYWTHRDAL
    DNKEVPASLTIVGGGVIGMEFASFFTSLGVQVTVVEMLDEILGGMDKELSAMLRAEYAKKGIKFLLSTKVVGVSKGETGI
    TVSYENADGTGTVTADKLLMSVGRRPVTKGFGLENLNLEWTERRCIKVDEHLQSSVPGVYVCGDLNGVSLLAHTAVREAE
    VAVHHITGKEDVMSYRAIPGVVYTNPEIAGVGMSEEALQAAGIPYRAVKLPMAYSGRFVAENEGVNGVCKVLTAEDGTVL
    GAHMLGNPASELIVLAGMAIEDGKTIEDWKRYVFPHPTVGEIFREL

    >gi|150003876|ref|YP_001298620.1| thioredoxin [Bacteroides vulgatus ATCC 8482]
    MNKTILFFLALVLAATTACGRGSSNNNPVKEETMATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADW
    CGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFLLKK

    >gi|150004439|ref|YP_001299183.1| thioredoxin [Bacteroides vulgatus ATCC 8482]
    MALEIKDSNFEELLASGKPVVVDFWATWCGPCKKIAPDVEALAEEYKDQVIIGKCDVDDNDELTGKFGVRNIPTVLFIKD
    GEVKDKTVGAVTKAQLEEKIKALL

    >gi|150004484|ref|YP_001299228.1| hypothetical protein BVU_1933 [Bacteroides vulgatus ATCC 8482]
    MKHIILIVSLLMGVTLGVQAQPKALFDKTTHEFGTILWKNPVTATFKITNKGDKPLVISNVTTSCGCTVADWTKEPIAPG
    KTGIVSSTFDAKAIGRFQKSVGIYCNASNKPIYLAIRGEVTADPKNYTFTHPFQIGAIRLDKEEIEFEDANKGDKPTMEL
    LVANTSDKLYTPVLMHLPPYLSAVATPEKLGRGRTGKIKITLDTDKLPKLGLTTASVYLSRFPGDKVGEENEIPVSAILL
    PDFSHISQQERLNPPAIHLSAKELQMGELKSDEKKAHTIIVKNVGKSNLEILDLQVFNSALGVQLKKRVLKPGASTKLKI
    TAFGQNLKKVKGTPRVLMITNDPNNPKIIIKVKVTSKK

    >gi|150004527|ref|YP_001299271.1| putative thiol-disulfide oxidoreductase [Bacteroides vulgatus ATCC 8482]
    MRTLKSIMVLGLALSTFTATEAAKLTFKVTNPNEKVKVRLTFSQSGEQKEVAIDAAGNGNIEITGFTPQYVTMQYTRGRR
    TLYLDPNQDLTLSFDSDNMWRNTTFEGAGAAINTYLGSKELQSLGMPDMKMQEAALIHKGDSLYAANCQVLEAAKLPADF
    TAQEKIRLQFYTYYYFSKYALYHPHFGKDDNYIPSKAYYEKLEAITPINAGLLALKEYKAFLPDAISAFSNKGKTVASNS
    TEQSVNYVDATIQDEKVAEFLIDQFVYNFVDNNGLDEADGLIVLFRKHVKDAKSIEKFNALCTKWEKLRSGNPSAASFSY
    PDINGKTVSLADLKGKYIYIDVWATW
    CGPCRGELPALKELEEKYAGKDIHFVSLSCDKNKKAWENMVTKDQLKGIQLHMG
    TDRTFMDAYLINGIPRFILLDRDGKIISANMTRPSDPKTAEKFNELLGL

    >gi|150004528|ref|YP_001299272.1| putative disulphide-isomerase [Bacteroides vulgatus ATCC 8482]
    MKKYILLIFACIYAIHLNAQNAGINFLHGTTWAEAVAKAKAENKLIFIDFYTQWCGPCMNMAQTVFSLPTVGYYYNQTFI
    NLKIDAEEGEGITLAKKYGVRSYPTYAFVDPATEEIVHRSSSRQTPEQFIQTGKDANIPTKRSFYLQEQYTKGNRERAFL
    IDYINYHYSVYARNNVQAAFDELIKGGAKLTDPDVWEVYVNTINGMNPYLKQVSDNYADFCQRFGKKAVDAKLAKETSYG
    ELAEIEALCNYEGKDFNLKMIRINNDIREQKYEAAATQIDAMIADTTVNQQELISRLKFIARLGYKAEELPEFWFNKCVG
    YLQYIAYNQTDRDDAFIHQEYAAALEMVLRKLNGKAPIPACLSTEPAYGKKVYNMRPDALKMKPKRKK

    >gi|150004554|ref|YP_001299298.1| putative thiol-disulfide oxidoreductase [Bacteroides vulgatus ATCC 8482]
    MKNLVYALVGAGFMIACQPSDQPEISGMLTGIESDTLLVQSFPVNDRDSRRTDTIAMQNGSFAFNLGDSVLKQVYIYGKP
    SVKPNEDGSIPAISMKAINFLLLPGQPIKISGSLDEYKLEGGSFYDDYNEVLEDCKAYSHKIDSLNVVCMDMEKKGIPGD
    SIRKVYASAKEWYGNILKIKSDYVRQNPDKDVSVYVMSQLTRDQLGDAFNVLTDRVKEGMMAPLYQRMREGYEKELARDK
    AKEAMKPGNPAPEFTLKDLDGKNFDLSSLRGKYVVLDFWGSW
    CGWCIKGIPEMKKAYEKYKGKIEFVGIDCNDTEDKWKK
    AVAEHQLPWINVRNIGEPDVAVMYGVSGYPTKYVIDPEGKIAKQVVGEDPEFYMYLDALMK

    >gi|150004555|ref|YP_001299299.1| peptide methionine sulfoxide reductase [Bacteroides vulgatus ATCC 8482]
    MKVEKAIFAAGCFWGVQHQFERIPGVLNTTVGYTGGPEANPTYTQVKAHMTHHVEAIFVDYDADMVSYVDLCKLFFEIHD
    PSQTDGIGPDLGPQYRSMIFYMDEKQKSEAEEVIELLRSKGHRVNTKLRPAEKFWEAEDYHQHYYDKTGGEPYCHIRVKK
    F

    >gi|150004632|ref|YP_001299376.1| putative exported cytochrome C biogenesis-related protein [Bacteroides vulgatus ATCC 8482]
    MKKKFFLSCLLIVMALLPAVAQIQDPVQFKTELKTISDTEAQIVFTGKIDAGWHVYSTDLPSGGPISATFNVDKIEGVEL
    VGKLTPQGKEIENFDKVFEMKLRYFENTAIFIQKLKITGATYMIEGYMEFGACNDENCLPPTEVSFSFSGKGVAAATTSK
    TTEPAKTETAITEVPVAETATATTATDSATTAALIGNDTAVQDYWTPVIQELNAFGETTSQQDRSWIYIFFAGFIGGLLA
    LFTPCVWPIIPMTVSFFLKRSKDKKKGIRDAWTYGASIVVIYVLLGLAITLIFGASALNALSTNAIFNIFFCLMLIVFAA
    SFFGAFELTLPSKWSNAVDSKAEQTSGLLSIFLMAFTLSLVSFSCTGPIIGFLLVEVSTTGSVVAPAIGMLGFALALALP
    FTLFAMFPSWLKSMPKSGGWMNVIKVVLGFLELAFALKFLSVADLAYGWGILDRETFLALWIVIFALLGFYLLGKIKFPH
    DDDDDKVGVARFFMALISLAFAVYMVPGLWGAPLKAVSAFAPPMNTQDFNLYTNEVHAQFDDYDAGMEYAKRTGKPVMLD
    FTGYG
    CVNCRKMEAAVWTDPKVNKLMTEDYVLITLFVDNKTPLPEHIKVMENGKERTLRTIGDKWSYLQRSKFGANAQPF
    YVLIDNEGKPLNKSYSYDEDIDKYVDFLQTGLQNYKK

    >gi|150004738|ref|YP_001299482.1| thiol-disulfide isomerase and thioredoxin [Bacteroides vulgatus ATCC 8482]
    MKRMVNVLFAGVLAMTVLSCGEEKKGYTLNGEISDVKDGMVYLKKYQDKSFIAVDSAVITDGTFKFEGVCTEPLAYGLTT
    FRDSKRPLVFFLDNEKMQLKMNESEKILTVTGSAINDLYAQNAPLTRQDGYSIDSLVAVHPASAVTPYFIVKDFAYKLNL
    EEMKALRAKLDASLDETMYVSQIDGFIKRMKDIQVGAVAPDFTLPDVDGNPVTLSGLRGKYVLIDFWASW
    CPDCRKENPN
    IVAAWNKYKDKNFTILGVSLDRKKEPWLAAIEKDQLAWTHVSDLKDWKSDAAVQYAIRWIPMNFLLDPNGVILAVGLEGE
    ALQQKLDEVLK

    >gi|150004760|ref|YP_001299504.1| putative thiol-disulfide oxidoreductase [Bacteroides vulgatus ATCC 8482]
    MRKNIFFIVFIILCAVSCTEKKSNFINTVHLKGQLLDMGSQNVRMRFDGAASMLGDSRDILLKTDAAGYFDTTFVLKEPT
    YYTISRNTLYLTPGDDMTIKVTQTNTEAEFSGIGAEANNYMKFRLFPKGGSYLEAGGNLRGDFVSTKALVDSLAAIRMHT
    LDTLSNVSDAFKKLETARIKADIINSYICYASYSRMFAEVKNEEEMRAKWNEFNVSLTQDVTPLYKEIVNEDMLNVAVVR
    DVLSYQEDSTLASLWFKDISIPARTTELYACAKIVDNLRNEASEQTVNEAKAFLQTVKNADFATEIEGKIVQASKLLPGQ
    PAIDFEMLDVEGNVKHLADFKGKVIYIDLWATW
    CGPCIQESPAFEALGKKYVGKDIVFLPVSTDTTTKPWLRYLDGHKKE
    LTQYHSNDVALKESWAIMYIPRFILIDKDFNIVNAYAPRPSSEEIGTLIDSVLNK

    >gi|150004761|ref|YP_001299505.1| putative thiol-disulfide oxidoreductase [Bacteroides vulgatus ATCC 8482]
    MIYKKYLLLGVSLCMLNACNESKSVSLEGSLDGIQADSIYLYQVDNEHYGSVKLIKSIAVTDGRFAYPTDSIQAGLYCFS
    LQNMERGEYLQQYANLFLEPKSMQLTLGKDKYDQLSLHATGSALQEQYEALQEAKYVAGNRMVLDSLDHMFYEAREKGDR
    EEMERIREVSSPYYESASEQTRKLINGEIAKNKGSYFGLYLYYTYRFQNHTFNTVEEIDEARNFIGSFDEASRRSGIYVK
    MQEGLDKFARCATGSVAPAITGIDLKGNSVSLNDFKGKYVLVDFWFAG
    CSWCRKETPYLLKTYNAFKDKGFTIYGVSTDR
    REEDWKKAIEEDKSYWNQVLLQKDDVKDVLESYCIVGFPHIILVDPEGKIVAKELRGDDLYNTVEKFVNGAK

    >gi|150004827|ref|YP_001299571.1| hypothetical protein BVU_2290 [Bacteroides vulgatus ATCC 8482]
    MKPVKLFYQERCPFCKKALRYIEELKAEYPEFQPIEIEMIEETQHPDIADQYDYYYVPTFYVDGVKVHEAGIFKNEMEAL
    LRKVIE

    >gi|150004905|ref|YP_001299649.1| thioredoxin [Bacteroides vulgatus ATCC 8482]
    MKKTITCILLTAGLTGYLSAQTPVQDKSDKNSGKVIRMDKQMFLDNIFDYTSGSTNWKYKGEKPAVIDFYATWCGPCRMV
    APLLKSLAKEYKDQIAVYKVDTDKQKELSAVMGIQSLPTIIFIPKTGQPQIIIGAANKATFRKAIEEVLLKE

    >gi|150004906|ref|YP_001299650.1| thioredoxin [Bacteroides vulgatus ATCC 8482]
    MERFEDLITSNIPVLVDFFAEWCGPCKAMKPILEELKGIKGEKVRIVKVDVDKHKEIAAYYQIQSVPTLMIFKNGKQLWR
    QSGVMRANDLSTILAQYE

    >gi|150004915|ref|YP_001299659.1| putative bacterioferritin co-migratory protein [Bacteroides vulgatus ATCC 8482]
    MNIGDKAPEILGLNEKGEEIRLSNYKGKKIVLYFYPKDMTSGCTAQACNLRDNYAELRAHGYEVIGVSVNDAKSHQKFIE
    KNELPFTLIADTDKKLVEQFGVWGEKSMYGRKYMGTFRTTFIINEEGVIERIISPKEVKTKEHAQQIL

    >gi|150004959|ref|YP_001299703.1| pyridine nucleotide-disulphide oxidoreductase [Bacteroides vulgatus ATCC 8482]
    MKYIVIGGVAGGATAAARIRRNTEQAEIILFEKGEYISYANCGLPYYIGGVIAEREKLFVQTPEAFGKRFNIDVRTRSEV
    IAIHSADKTVDIRTSDGKTYTESYDKLLLSPGASPVRPPLPGIDNEGIFTLRNVNDTDAIKSYLQQHKVKRAVIIGAGFI
    GLEMAENLQEAGAEVAVVEMANQVMAPIDFSMASLVHEHLLQKGVHLYLEKAVASFERTVNGLEVIFKSGERLPADMVLL
    SIGVRPNTSLVTEAGLEIGEMRGIKVNDYLQTSDEYIYAVGDAIEFRHPLTDRPWLNYLAGPANRQARIVADNMVFGNKV
    TYEGAVGTSIAKIFDMTVAASGLPAKRLKQAGIDYLSATIHSGSHAGYYPDALQMSIKITFSPVNGKLLGAQIVGYNGVD
    KRIDEFSQVIKHNGTVYDLMALEQAYAPPFSSAKDPVAVAGYVAGNILSGKMKPLYWRELQAADLSKVTLVDVRTPDEFA
    LGALKGAVNIPLDDMRERMKEIPQDKPVYLY
    CGVGLRGYLASNILLQNGFGEVRNLIGGLKLYKAATAPLPKPKEFSNSG
    SSSSDSSKVDHSEHSKDSAEAYTIASSVIPSMKAIKVDACGISCPGPIMKLKKSMEELADGERLEIVATDAGFPRDAEAW
    CQTTGNRFVSVKSGAGKYEVIVEKSTPQSSSSEVCREDKGKTFILFSDNLDKVLATFVLANGAAATGKKVIIFFTFWGLN
    AIKRLDKPAVKKDIWGKMFGMMLPSSSLKLRLSKMNMGGMGARMMRYIMNKKNIDSLESLRTQAIQNGVEFIACQMSMDV
    MGVKREELLDHVTIGGVATYMNRAEQANVNLFI

    >gi|150004966|ref|YP_001299710.1| thiol:disulfide interchange protein [Bacteroides vulgatus ATCC 8482]
    MKLMYLLATFAVVLVMMASCTRQSVTGYTLTAAIDGIPDGSHVQLFPVSHGHEKPVADTTVVDGKFIFKGVADEPLAVRL
    MVKDAYGSMPLMLENGSISVEGKVTSENLNGTVNYNFSQVSVTGSPLTDKYVKLLSTRDALDSIYVTNNEKFKDIRVAYG
    KARVAKDKILMDSVVATEAYKASAVADSLFFATVDATYYKLVMDNKESYWGPLMMISLFSYLTEEQKPWYDALSEEAKHS
    RYGKMVKESVAPDSQIGSKVPVFTAKSQDGKSVTLTDLCQGKKYVLIDFWASW
    CNPCRKEIPNLKKLYTQYADRGFQIVS
    ISIDKKEAEWTKALKEEQLQWPNFLDTEGIADIYKVKFVPTMYLIDAQGVMVGENLRGEALANKLAELFGEIE

    >gi|150005038|ref|YP_001299782.1| putative thiol-disulfide isomerase [Bacteroides vulgatus ATCC 8482]
    MGMKMKNWIKTVCFLLWTCVMCTACIDDDVEEGTVDLQTGESIPVFSVVMDDGQIITSETLKGEVSLIVFFHTGCPDCRK
    ELPVLQKIYTDYGRRIRMVCISREESSAEIVRYWDENHLTLPYSAQENRTVYYQFAKSGIPRVYVIDKELVIRSVFTDNP
    LASYEDLAEAITASL

    >gi|150005084|ref|YP_001299828.1| thiol-disulfide isomerase and thioredoxin [Bacteroides vulgatus ATCC 8482]
    MEWFKKKMRVFLFVCLLFPFYSYAAKISLSISGKIEDHSAMLYFPDGRELPISIDASGKGELVVDVTEPVYVALGYHYIS
    RTLLLTPDTDIQISFENKKFGERVAITGTGSQVNIYLNNGRLKAAKIDDMALGEKAFFLKMDSILNVNLQELDHAGLSEE
    INEMEKIRLKYFTCATLPSYPYFHMRIAKDSTYEASLEYWSKLQELMVMDASLLRYDEFRSFLVEAVSRVARKQYPESKS
    LDAVVRYVESEVKEPGIAEFLINKNVYAYVERYGLDSADAYCAVFDRYVKSPLLVKNFETLCNRWRKLSVGALSPNFNCT
    DLSGKKVSLSDFKGKYVYIDIWATW
    CGPCQREIPHLQKLEEKYHGKDIYFVSISCDNNKKAWENRVRAGLKGIQLHFVNG
    DTFMNDYMIKGIPRFILLDKEGKIISVDMSRPSDPKTIAKLDELLN

    >gi|150005287|ref|YP_001300031.1| hypothetical protein BVU_2759 [Bacteroides vulgatus ATCC 8482]
    MKKILLSTLLLIIGLTTYAAVWQSQGEAEITFEKTTHNFGSFPESSPKVTCVFKFKNSGDGPLVIHQAIASCGCTVPQYP
    KEPIKPGESGQITVTYNGAGKFPGHFKKSITIRTNGKNEMTRLYIEGDMTPKSTVAE

    >gi|150005539|ref|YP_001300283.1| cation-transporting ATPase [Bacteroides vulgatus ATCC 8482]
    MNMSDMTKKLYPVTGMHCAACAGNVEKIVRKQEGVENASVNLAAATLAVTYNPDIVSPQQLKEAVMKIGFDLIIDEDNSV
    QEQEEAEQSYYGQLKRKTIVAWIFALPVAVLGMFLMNVPGVNWWMLLLSLPVILYSGRSFYMNAWKQTLQRTSNMDTLVA
    LSTSIAFLFSLFNTFYPEFWYSRGLEPHVYYEAATVIIAFVLVGKLMEEKAKGKTSTAIRKLMGLQPRTARVVKDGREED
    ILIAELQVGDKVSVRPGEQIPVDGVIVGGNTFIDESMISGEPIPVEKKQGDKVLAGTINQNGAFTMTAQKVGKNTVLAQI
    IRMVQEAQGSKAPVQRIVDKVTAVFVPVVLAVAVFTFLVWIVAGGADDFSYAMLSAVSVLVIACPCALGLATPTALMVGI
    GKGAESHILIKDAVALEQMRKVDTVVLDKTGTVTEGRPVVTGWLHDAGWQNEHKGILYAAELKSEHPLALAIVEALKKEG
    EKPALIDSFESRTGRGIVVTRGNKTFWAGSHRLLKDFGAGISDLLKGMVEDYEKSGKSLVYFGEGNTLLAVIAISDKIKD
    TSRQAVKQLKESGKYIVLLTGDGHLTAQNVAGEIDANRFISDALPVDKENVIKELQAEGRVVAMVGDGINDSQALARADV
    SIAMGKGTDIAMDVAMVTLMTSDLLLLPKAFKLSHKTVRLIHQNLFWAFIYNLIGIPVAAGILFPLYGILLNPMIASAAM
    ACSSVSVVLNSLSLNWRKL

    >gi|150005585|ref|YP_001300329.1| thiol:disulfide interchange protein [Bacteroides vulgatus ATCC 8482]
    MRTKAVLFFLLLLPVYVVNGQDDKREYLKKVLDNLEQIKSATYKVEGEVWNPGDTIPSSIRKYMVKEFDNPADSTIGASF
    VNLGTDDGKEFQFGYNGEVRVLVNHAVKEIKIDNFTTRPLPFRPLTPPFFNYCKNIVRYTLETEDSIVTTLEDCGDYFHF
    KLVINEDTQVEFFGKAYHMPPPPFYVEPTSIYELWIHKSNGLPYKKRRAMSHNISVETCCNVEINKETIDRFDVFDYVPQ
    GYETKKYDYGAPSRNMAANLTGKKAPEWTLNDIKERPVSLSDLKSKVILVNITGIG
    CGACQASIPFLKELKRKYQEEDFE
    LVAIESWSRMHSLQNYAKRKELNYMFLDGDDKVIEDYRTGGAAPYFFILDKERIIRKVIRGYGMGKTDKEITETIEELL

    >gi|150005710|ref|YP_001300454.1| hypothetical protein BVU_3203 [Bacteroides vulgatus ATCC 8482]
    MMFQTFLVDAGNRVKVIGNPIHNLSVKELYLKEIAGIKSTAWSVTIIQLDSTEYHYDTVGENETVDKKITLYNAGKEVFR
    IKGVTTS
    CDCMMVNYGWDEIQPGESAVMTVSYKAEEPGDFWRTITVYGNVAEKSFTLDFYGSVRTGDG

    >gi|150005726|ref|YP_001300470.1| putative thioredoxin [Bacteroides vulgatus ATCC 8482]
    MDITGKIEEVNQSDSLLLVVFYADWSPHCEWIEPLLHEFEKPVNIVRVNIESNRKVADAYEIEIAPSFVLQRKGKMLWEK
    TGEVFPGELRDVIEMFKN

    >gi|150005728|ref|YP_001300472.1| methylated-DNA-protein-cysteine methyltransferase [Bacteroides vulgatus ATCC 8482]
    MKEKNTIKIKSYESPCGVLLLGSFGGKLCLCDWQVEKHCDRVNQRLKRVLCAEFEISTSEIIEESIEQLNEYFAGQRKEF
    SVPLLFVGTDFQKTVWNELLKIPFGRTMSYGEMARHIGMPQAVRAVANANGANSISIFAP
    CHRVIGSDHSLTGYGGGLSA
    KRFLLELESQPRLML

    >gi|150005744|ref|YP_001300488.1| Na(+)-translocating NADH-quinone reductase subunit D [Bacteroides vulgatus ATCC 8482]
    MSALFSKKNREVLLTPLGLNNPVTVQVLGICSALAVTAQLEPAIVMGLSVTIITAFSNFVISLLRNTIPNRIRIIVQLVV
    VAALVTIVSEILKAFAYDVSVQLSVYVGLIITN
    CILMGRLEAFAMMNGPWESFLDGIGNGLGYAKILIIVAFFRELLGAG
    TLFGFQVIPQAVYDLGYLNNGLMLMPPMALIICACIIWYQRAKHKELQESNN

    >gi|150005745|ref|YP_001300489.1| Na(+)-translocating NADH-quinone reductase subunit E [Bacteroides vulgatus ATCC 8482]
    MEYLSLFVKSIFVDNMIFAYFLGMCSYLAVSKNVKTAVGLGAAVTFVLIVTLPVNYLLENYVLAPNALIDGVDLSFLSFI
    LFIAVIAGIVQLVEMAVERFSPSLYASLGIFLPLIAVN
    CAIMGASLFMQQRHFNNIGEATTYALGSGIGWALAIIGLAAI
    REKMAYSDVPAPLKGLGITFITVGLMAMAFMCFSGLKI

    >gi|150005962|ref|YP_001300706.1| glutathione peroxidase [Bacteroides vulgatus ATCC 8482]
    MKTFILSIIVTMITSVAGAQQKSFYDFTVKTIDGKDLPLSTFKGKKVLVVNVASKCGFTPQYAKLEELYEKYGKDDFVVI
    GFPANNFLHQEPGTNEEIKEFCTLNYGVTFPMMAKISVKGKDIAPLYQWLTHKSENGVSDAKIGWNFHKFLIDENGRWVA
    SIGSTTSPLSQEIVGWIEE

    >gi|150006053|ref|YP_001300797.1| thiol:disulfide interchange protein [Bacteroides vulgatus ATCC 8482]
    MKKLVYLLAAGSMAFVACQNSPSYKVTGSVEDITDGDTIYLQEYAGGNLVKLDSAIVKSGTFVFTGKQDTAVNRYITYMK
    GDKRYFTDLFLENGNINVTLGKESKVSGTPNNDAYQKFKDGFMALSKEMNEMYQKAQSDTSLTEEQVEAIMAEIEKKDSV
    GMDMVYQTIEANITNPVGVYLLPSYAGAFELDKQKALVEKIPAALVNERINKLKAHIETSEKTAVGQKYIDFSMQTPEGK
    TVSLSDFVSKNKYTLIDFWASW
    CGPCRKEMPNVVEAYKAFKDKGFGIVGISLDENADKWKEAITALNITWPQMSDLQGWN
    NAGAKLYGVNSIPATVLVDQEGTIVARNLRGDAIKSKLNELLK

    >gi|150006117|ref|YP_001300861.1| thioredoxin reductase [Bacteroides vulgatus ATCC 8482]
    MSTEKVKCLIIGSGPAGYTAAIYTGRANIAPVLYEGLQPGGQLTITTEVENFPGYPEGISGTQLMEDLRKQAERFGADIR
    NGIATSADLSKRPYRITIDDEKVIEAETVIISTGATAKYLGLEDEQKYAGMGVSA
    CATCDGFFYRKKTVAVVGGGDTACE
    EAVYLAGLAKQVYLIVRKPFLRASKIMQARVMNHPNIKVLFEHNAVGLYGENGVEGVHLVKRQGECNEERYDLPIDGFFL
    AIGHKPNSDIFKDYLDTDEVGYIITEAGTPRTKVPGVFAAGDVADPHYRQAITAAGSGCKAAIEAERYLSANDLL

    >gi|150006366|ref|YP_001301110.1| Na+-transporting NADH:ubiquinone oxidoreductase, electron transport complex protein rnfA [Bacteroides vulgatus ATCC 8482]
    MEYILIFITAIFVNNIVLSQFLGICPFLGVSKKVETATGMGAAVAFVLTIATIVTYLIQKFVLDAFGLEYLQTIAFILVI
    AALVQMVEIILKKVSPALYQALGVFLPLITTN
    CCILGVAILVIQKDFDLLTGVVYAFSTALGFALAMVLFAGIREQLSLV
    NIPKGMQGMAIALVTAGLLAMAFMGFSGVDKGLGVLFGIE

    >gi|150006367|ref|YP_001301111.1| electron transport complex RsxE subunit [Bacteroides vulgatus ATCC 8482]
    MNNFKVLMNGIVKENPTFVLLLGMCPTLGTTSSAINGMGMGLATMFVLICSNVVISSIKNLIPDMVRIPAFIVVIASFVT
    LLQMIMQAYVPALYATLGLFIPLIVVN
    CILLGRAEAFAAKNGPVPSFFDGLGMGLGFTLALTILGGVREFLGTGKLFDIA
    IMPEQYGMLIFVLAPGAFIALGYLIAIVNKLKKA

    >gi|150006425|ref|YP_001301169.1| putative thiol peroxidase [Bacteroides vulgatus ATCC 8482]
    MAKTAFKGTPVTLAGEFVKAGTSAPEFTLVKGDLSNYTLKDGKGKYLILNIFPSMDTGVCATSVRKFNQLAANQPNTVVL
    AISKDLPFAQGRFCTTEGITNVIPLSDYRYTSDFAEKYGVLMTDGPLAGLLARSVVVIDPEGKVVYTELVPEITQEPNYE
    AALKAVK

    >gi|150006585|ref|YP_001301329.1| hypothetical protein BVU_4105 [Bacteroides vulgatus ATCC 8482]
    MKKFMSLMLLVCACLLSQPVKAQQVTPDNAGYIVKVGDMAPDFEMELTDGQKVKLSDLRGKVVMLQFTASWCGVCRKEMP
    FIEKDIWLKHKDNKAFALFGVDRDEPLETVVAFAKRTGVTYPLALDPGADIFARYADRKAGITRNVLIDKTGKIVMLTRL
    YNEEEFSSLCKKIDEMLGEK

    >gi|150006661|ref|YP_001301405.1| hypothetical protein BVU_4182 [Bacteroides vulgatus ATCC 8482]
    MEIKVLGTGCSSCKALYETTKQAISELGCDATLIKEEDLLKIMEYNILGLPALVIDGKVVSAGKRLSLSEVKELITK