Zunongwangia profunda SM A87 uid48073

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|295131972|ref|YP_003582648.1| rhodanese-like domain-containing protein [Zunongwangia profunda SM-A87]
    MQLYNKLSAKEREALIEEAGEDRLTLSFYAYAKIGNPKLFRDHLFVAWNSMDVLGRIYVAHEGINAQLSVPAKRFNEFKE
    FIDNIYFLEGCRLNIAIEQDSKSFLKLKVKVRDKIVADGLNDASFDVTNKGIHVDAATFNQLLDDPNTVCVDMRNHYESE
    IGHFQGAVTPDVDTFRDSLPIIEKDLEEHKEDKNLLMY
    CTGGIRCEKASAYYKHRGFQNVYQLEGGIIEYARQVKNQQLE
    NKFIGKNFVFDHRRSERISDDVIAHCHQCGKACDTHVNCANEACHLLFIQCEECAMEMNNCCSEDCMKVNALPYEEQKEL
    RKGKRNSNKIFKKGRSEVLKYKS

    >gi|295131984|ref|YP_003582660.1| methylated-DNA--protein-cysteine S-methyltransferase [Zunongwangia profunda SM-A87]
    MALLEIPFGKTCSYMELSKKLGDPKAIRAVASANGKNPLWIVVPCHRVIGSDGSLTGYAGGLYRKKWLLALESPAAQQSL
    F

    >gi|295132014|ref|YP_003582690.1| thioredoxin-like subdomain protein [Zunongwangia profunda SM-A87]
    MAKKMIKNLQIFILFLALPILSYSQKVNTINWLNFEQLEDSLARKPKKTFIYFYADWCVYCKKMEQNAFKNAEIIEKLNS
    DFYAVKMNAESTDTINFEGQKFYNQQAESMRNGIHQIPLLLASRENFEFSLPVILILDEKFRVKNREFEYLTTKKMMELI
    SIH

    >gi|295132016|ref|YP_003582692.1| rhodanese-like domain protein [Zunongwangia profunda SM-A87]
    MNPIIPAIVIVILLGSYFVLKNYNNRKRDQSLKGKNISQFQILDVRTPREFKQGHIKNAINFPLGIINSDSLKKLNKELN
    YITY
    CAHGIRSVKASKILKENGFKVTNGGSIKDLQKLIAYSENRN

    >gi|295132098|ref|YP_003582774.1| HesB/IscA family iron-sulfur cluster assembly scaffold protein [Zunongwangia profunda SM-A87]
    MIKVSEDARKKISALMEEEGFNSLQDFVRVGVKSGGCSGLSYELKFDKSKADDDKLFEDNDIKIVVDKRSVLYLAGTILE
    YSGGLNGKGFIFNNPNAQRTCGCGESFSL

    >gi|295132167|ref|YP_003582843.1| putative thioredoxin [Zunongwangia profunda SM-A87]
    MSTFGDIIADENPVLIDFYADWCGPCKTLAPILKEVKTELGENIKIIKIDVDKNQQLAAKYQVRGVPTMMLFKNGAQLWR
    QSGVIQKQDIINIIKSKA

    >gi|295132219|ref|YP_003582895.1| hypothetical protein ZPR_0339 [Zunongwangia profunda SM-A87]
    MKKIYYLSTCDTCKRILNDIEAPADFELQDIKTDEITKKQIEEMQALVGSYESLFSKRARLYKERDLKNKDLSEEDYKAL
    ILEHYTFLKRPVIINGKEIFIGNAKKNVAAAKESIHG

    >gi|295132263|ref|YP_003582939.1| Thioredoxin-like protein [Zunongwangia profunda SM-A87]
    MRLFNVLKIIPVFTLLAISIVFTGNLWGQDQEEVFSVAPRYPKAGDQVTLSYDASQTPLKNRDSLTAVVYTYADFQWNVK
    DLKLERTEENKWQGQLKLEPGIALINCVFYAKDTLDRGGANTYSWMINNAPGSYSGWGIMRNPNINEDFPQQLDSLSFIE
    DSVTLMWLNNEMRDNPSSRSHIFYSGLRLLQRTNTEDQTGRIKEELNYILSFPALDLKQQYDVQRSLELITGNETYVDSV
    ENALLSKYPNGVLARDRAIKQLFREADPDERVKAYNAFVNQFPEEKFEGITTTTEELYYDKLFRSIAYTYILENKDYGFV
    FDNLTNASYTNLVDYAWHLVSIPYTNESMSLDSLQVFADRIFPEIESREHEVPKAYRGKLSPNQWKAMALKAAASEYLTY
    AKILNEQQDYKREAYYLNKIAALLKYENTEYNALYTQQLVRQDKMDEAVSFIAACLRHNNTSPEMLQVLKDEYLKSGKEL
    SDFKDYVAGLKTGAENQKEKEALLTELIKKPIEDFSLESSYGGMVNLKDQLGKIVVIDMWATW
    CAPCKKAMPGMKMVVDH
    YADDANVKFYFLDTQEYVKDYKTKTAAFIEEKEYPFEVLYDAVNPENGKPEMVYTKYAKAFQFSGIPQKMIIDQNGYLRW
    RSTGYEGSPSALADEIKTIVEYLKAESKS

    >gi|295132265|ref|YP_003582941.1| cytochrome c biogenesis protein, transmembrane region [Zunongwangia profunda SM-A87]
    MRLFITGIFFLIVSLAQSQIYDPVSFKPDVQKIDDTHYALSIHASIEPGWHLYAQNVPDGGPVPTQFEFTTSDAYELNGS
    VSEPQGHVVDDPIFEMRIKYFSDSAEFQQVIERKTAEAFSVKASVEFMVCNDESCLPPTIKEVVFELEATAATLNEEATK
    PLQKTNEVEEQTVPKNGDATKSESTEVEVVNAEEQDTLTLKEGDQPIKKPNSDLENTKAEQEEEAADSRNLISIFILSFL
    GGFAALLTPCVFPMIPMTVSFFTKQSKTRASGIKNALLYGLFIIVIYVVLGSVVVAIFGADSLNALSTNVWFNLIFFGLL
    LVFAFSFLGAFEIVLPSSWVTKIDSQADRGGLIGIFFMALALAIVSFSCTGPIVGTLLVESASQGGVAPIVGMLGFSMAI
    ALPFALFAAFPGWLNSLPKSGGWLNTVKVVLGFLELALAFKFLSNADLVLQLHLLERETFLAIWIAVFGGLALYLFGKIT
    LPHDSPLAHISVGRLSLGLFVLAFVVYLIPGLWGAPLQWISGFPPPAQYSESPYGVGNTKGVSGTSIELPPHAELGPLDL
    VTFKDYEAGMAYAKKVNKPVMLDFTGYA
    CVNCRKMEERVWPEPQVQQVLRDELILISLYVDDKKELPEAEQYVSETTGKK
    IKTIGNKWSDFQIKHYKANAQPYYVLIDNEGENLNDPRAYDPDVDSYLSWLQEGIKNYNNK

    >gi|295132271|ref|YP_003582947.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Zunongwangia profunda SM-A87]
    MQCKNSDSNENSEEKEQFKISGKIKNQPDGMIYLEELDVPEGASSLVDSVQLQNDQFTFSGKVDFPKWYAIKTSDTTEWP
    LRIVLSNEDITINAVKDSLYKAKVNGASVYAEYQDYYDTYFEKIRSKARPIYQLLDSLNQGGKRELAKKERLMMDKKWEE
    MSRFSDSITKLYVSNNPGSLAAPMIISERYIQYADPDRADELYQLLDPKAQSSFYGKKLSKALEGYKSVAVGSRAPAIKN
    QVDLEGNKIGLEDYKGKFVLVDFWASW
    CGPCRKENPNVLKAYNTYHSKGLEILAISLDEKRELWEKAIKKDKLPWKHVSD
    LKGFKNQAAQDYMVSAIPQNFLINPEGEIIATNLREEGLHEKLKEIFTN

    >gi|295132288|ref|YP_003582964.1| hypothetical protein ZPR_0409 [Zunongwangia profunda SM-A87]
    MNVKKPVFSYIEFYEWMVQLVNNKQTSGEKQTENLIQFTELNLSRMKRLNKTTKLIPELENLVTGLKKPQVWYVITEAWC
    GDSAQNLPVIGEIATAGDKIELRIVLRDENPELIEKYHTNGSKSIPKLIAFSEKGVELFTWGPRPKPAHDLVLDWKENPA
    GRDFEALEKELHTWYAKDKTQTLQKEFLHLLSALKN

    >gi|295132385|ref|YP_003583061.1| thioredoxin reductase [Zunongwangia profunda SM-A87]
    MIKTDMIIVGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSEIYPKKPIYDIPGFPEVLAGDLVSNLMEQIKAFEPGF
    TLGERAETIDKQEDGSFIVTTNKGTKHHAPVVVIAGGLGSFEPRKPPIPNIIDFEDKGVAYMIKEPEVYRDKKVVIAGGG
    DSALDWAIFLADVASEVSLVHRRQEFRGALDSVEKVEELSKIGKIKLVTNAEIVDLKGEEDLEAVVIRHKDTALGEEIKE
    TDYFIPLFGLSPKLGPIGDWGLEIEKNAIKVDNTYDYQTNIPGVYAVGDVNTYPGKLKLILCGFHEAAIMCQSAYQRIFP
    DKKYVMKYTTVSGVNGFDGSRKEAKKEVVKSIN

    >gi|295132488|ref|YP_003583164.1| six-hairpin glycosidase [Zunongwangia profunda SM-A87]
    MKSATNDLIYETSPYLLQHAHNPVDWKAWHKTVLEDAKKTNKLLLISVGYSACHWCHVMEHESFEDPEVADIMNAHYISI
    KVDREERPDIDQVYMQAVQLMTGSGGWPMNIVALPDGRPVWGGTYFRKEQWKSALLQIQQIYKKESTQLTNYANKLKEGL
    QQLNLIDIGNNSYEFSQKRLGEFIEIWKPYLDMKLGGTKNAPKFMMPTNLDFLLRYAYQFKDKKLQEYVLHSLDKISFGG
    TFDHIGGGFARYSVDDRWHVPHFEKMLYDNAQLLSLYSKAYKLTQDHWYKEVIKKTARFIETELTDSTGAFYSALDADSE
    NAKGNQEEGAFYTWKKEELEELLASEFDLFSAYFNINARGYWENGNYILYKTEKDDDFTKKHNISLEELYQKKSNWTKIL
    SEARKKRKKPGLDDKTLTSWNALSLNGFAEAYTATGKNHYLNIALKNAEFIIQNQLNPDYSLFHSYKNKQSKINAYLEDY
    AFTIEAFLKLYEVTFDKKWIDISSHLTKYCFENFYNQENTLFNFTSKKDDALISTPIELTDNVIPASNSVMANNLFRLGR
    LTGTSRYLEVSEKMLQVISGKIGSYPMGHSNWLHLYLNISNPFYELAILGEQIDREQKEIQKKYLPNLIISGSNTESELS
    ILKGRFVKGKTRYYLCEQGKCQLPKEELTHVLNNIALV

    >gi|295132510|ref|YP_003583186.1| E3 component of pyruvate dehydrogenase complex [Zunongwangia profunda SM-A87]
    MANSKKEKKELVIIGAGPGGYAAAFRAADLGIKTTLIDPEANPGGVCLYRGCIPSKALLHVAKVKKEALELANFGVRFGE
    PEIDVKKIGEWKDEVVKKLTSGLGQLSKARKVEFIQGKAFFKDEQTLEIKENSGDSYELEFENVIIATGSTPTELPNIEV
    DHQLIWNSKDALDIKEIPKKLLVIGGGYIGLELGSVYANLGSEVSVAEMTSGFLPGADRDLVKVFEKEHPFKNLYFDTKV
    EKVNAKKKKVEVVLKSGDKEQKKKFDKVLVAIGRKPNVKASKPQNAGVEIGQDGFIKVFSNRKTSANNIYAIGDITGQPM
    LAHKASHEGRVAAEVIKGEKGSAYDAKVIPAIVFTDPEIAWCGLTEEELKSSNIDAKVVKFPWSASGRAKALGTDNGLTK
    LIVDKESEIILGGGVAGKNAGSLIPEIALAIEMGTTARDLSLTIHPHPTLSETIMESAELFYGSPTHIVDK

    >gi|295132524|ref|YP_003583200.1| thioredoxin protein [Zunongwangia profunda SM-A87]
    MIVGAGVQAQEAESKINWMTMNEALEAQKETPKNIIMDAYTDWCGPCKMLDKNTFGHPKVAEFINENYYPVKFNAEGQEE
    IKYKDEVFANPQYKAELKGKRNSPHEFARALQISGYPSIVFFDEKGELIAPLTGYRTPAQIEIFLKIFAKDEYKKLTTEK
    AWNEYNENFEPTFSK

    >gi|295132550|ref|YP_003583226.1| copper-translocating P-type ATPase [Zunongwangia profunda SM-A87]
    MMKHKYNISGMSCQGCKSHVTKALENIPGVEQVEVDLERGSAEVAMQKHIEIEEFQQALKNAGGNYQISMPSENTSAAEE
    KLMTHKYHISGMSCNGCRSHVEKTLNEIGGVAKAEVNLEKAEATISMHQHIEIAEFQQALKNNGGGYEIHPAGHQYHHTE
    KSKNKKKSKTKGNGKWYCPMHCEGDKIYDAPGDCPVCGMDLVQEQSLSASSITYTCPMHPEIEEDKPGDCPICGMDLVSK
    NPEPDAQNSTYLKLRKKLWLSLVFTLPVFLIAMSDMLNNNPLYKIMDLEYWNWGQFVLSIPVVFYTAWMFFERAWKSVVN
    WNLNMFTLIGIGAGVAWVFSVLGLLFPGVFPDQFKTEAGTVHVYFEAATVILTLVLLGQMLEARAHDRTNSAIKELLKLA
    PNKATRIKDGKEEVVKIDEIEEGDILKVKPGEKIPVDGIIKEGKSSIDESMITGEPVPVEKSTDDKVTSGTINGNSSFTM
    VAQQVGDETLLSQIIQMVNDASRSQAPIQRLADKISGYFVPIVVLISVITFVVWAIFGPSPSYVYAFVNAIAVLIIACPC
    ALGLATPMSVMVGVGKGAQNGVLIKNAQALELMNQIDTLIIDKTGTITEGKPSVEKIVSVGGYSESDIAGFVAALNTHSE
    HPLATATIKYAKMREIEIEQASNFDSVTGKGVVGELQQKKLALGNKALLDEKGINSSGKIDREIEQFQQQGKTVSYLSVA
    GKVEGFVVISDPVKKTSKEALTKLIEDGVEVIMLTGDNERTAKAVADEMGIAFKAGMLPQDKMREVEKLQQQGRKVAAAG
    DGINDAPALAKADIGIAMGTGTDVAIESAEITLVKGDLKAVLKARKLSDKVMANIKQNLFFALIYNSIGVPIAAGVLYPF
    FGILLSPMIAALAMSFSSVSVIANALRLRAARLS

    >gi|295132597|ref|YP_003583273.1| carboxymuconolactone decarboxylase [Zunongwangia profunda SM-A87]
    MLGLENYLATTSLTDIEKELIKIRTSQINGCAYCIEMHTKDALGYGETHQRIFALSAWWESPLFDEKENVLLKMTEEITH
    IQQKGLTEDTYTAAQKHFTGNEIAQIIMQIGTINLWNRIGISTHLKHEN

    >gi|295132641|ref|YP_003583317.1| glutathione peroxidase [Zunongwangia profunda SM-A87]
    MKIYDFEVSTANGKTLDLKEFKNRPVLVVNTATKCGLAPQFEGLEKLHQQYKDDGLVVLGFPCNQFAGQEPESNDTMAET
    CKLNHGVTFTLTQKINVNGKETHPLFKYLKQRLPGTLGKRIKWNFTKFLIGPNGEPYKRYAPTTSPEKIEKDIQQLLK

    >gi|295132709|ref|YP_003583385.1| thiosulfate sulfurtransferase [Zunongwangia profunda SM-A87]
    MKELEQEEWREQLGKDANAAILDVRTEEEVEEGYIPNSKNIDIYKGQGFIDEVEQLDKDKNYYIYCRSGKRSAQACSILD
    QLGFSNTYNLKGGFMEWEGETAED

    >gi|295132717|ref|YP_003583393.1| Peroxidase [Zunongwangia profunda SM-A87]
    MSTIRLGDTAPNFDAETTEGKINFYDYLGDSWGILFSHPSDYTPVCTTELGTVANYKPEFDKRNTKVIALSIDDMESHKG
    WVKDIEETQEVKLNYPIIADEDKNVSNLYDMIHPNEDNKATVRSVFIISPDKKVKLTLTYPPSTGRNFEEILRVIDSLQL
    TAYHKVATPANWKHGEEVVISPAVSNEDAKGLFPKGYKEVKPYLRMTPQPNLD

    >gi|295132718|ref|YP_003583394.1| alkyl hydroperoxide reductase [Zunongwangia profunda SM-A87]
    MLALGTKAPEFELYDTVTDKTFDLEALKGPKGILIMFICNHCPFVKHVNSEIAKLGEEYQAKGFGIVAVSSNDVENYPDD
    SPELMKKAAQKEGYTFPYLYDEDQSVAKAYDAACTPDFFLFDENLELAYRGQLDDSRPGNEKPVTGKDLRNAMDAILAGE
    KVADDQKPSIGCNIKWKQS

    >gi|295132727|ref|YP_003583403.1| secreted protein containing DUF1573 [Zunongwangia profunda SM-A87]
    MKKGILLIAAVGTMFFTSCKDAGNSASEKVKAENVDAAAARDSKATVYPELSFDETEFDFGNIPQGEPVEHVFTFTNTGR
    APLVITNAKST
    CGCTVPEYHKNESIQPGETGEMLVKYNGSGRGQVQKTVTISANTENGQEQIKIKAFVEADKAS

    >gi|295132742|ref|YP_003583418.1| thiol-disulfide oxidoreductase [Zunongwangia profunda SM-A87]
    MKKLFKNEWLNIILIVIIIAMILPQTRTPIAIVFNKLIASNPSVTDVEERPQIESYNWILEDRFKNEVDFSQFKGKVILI
    NYWATW
    CPPCIAEMPSLEEVYQDYKDRVVFLFISGEDLETSQGFMNAKGYDMPVYRMKTNYPDPLEGYKLPTSYLIDKNG
    RIVIKKEGAADWNSKGFRNTLEELLED

    >gi|295132818|ref|YP_003583494.1| Na(+)-translocating NADH-quinone reductase subunit D [Zunongwangia profunda SM-A87]
    MKTDNKQTSTDSAQKAAEKKKDEMILFLSSSEEKEHFLSKNNRKLLSDPFNDNNPITVQVLGICSALAITVQLRPALVMA
    LAVIVVVAFSNIIVSLIRNLIPNRIRIIVQLVVVASLVILVDQVLKAYSYDVSKQLSVFVGLIITN
    CIVMGRLEAFALGN
    GVYKSFLDGIGNGAGYGFILIVVAFFRELLGSGKLFGYEVLGHKAPTLADSTGLYALGYENNGLMLLSPMALIIVGIIIW
    VQRARNRKLIEE

    >gi|295132819|ref|YP_003583495.1| Na(+)-translocating NADH-quinone reductase subunit E [Zunongwangia profunda SM-A87]
    MEYLNLFVRSIFIENMIFAYFLGMCSYLAVSKTVNTAVGLGAAVIFVLTVTVPINFLLDQYLLSPGALSWLNPEYANVDL
    SFLSFIMFIAVIASMVQLVEMIVEKFAPALYGALGIFLPLIAVN
    CAILGGSLFMQQKNFGGIGEAVTYGFGSGIGWFLAI
    IAIAAIREKITYSNVPAPLKGLGITFIITGLMAIGFMSFMGIKL

    >gi|295132827|ref|YP_003583503.1| thioredoxin-like protein [Zunongwangia profunda SM-A87]
    MTKFIPFMVAVLLGCSTVNISKESKNNEQITTQQSMLLGKFKKADLLQEPYAAWFEPRYEKFEPNAKAMETIKDNINDYE
    INIFMGTW
    CGDSKRETPRFFKILDESGYNLDKLTAIAVDYSKSTPEKYEEKVNLNRVPTIIFYKNGKEVNRFVEFAQESL
    EEDIAKIVSGKDYKNSYAE

    >gi|295132940|ref|YP_003583616.1| OsmC-like protein [Zunongwangia profunda SM-A87]
    MKTLYSAKVTTEGGRKGRTISDDGILDLQLSMPKSLGGEGGDYTNPEQLFAAGYSACFGSALEMVAKNANVDLGDYNVTV
    TIDLGQNEDEELDLSAVLDIYIPDIDVETGEDLINEAHEV
    CPYSRATRDNIDVTLNLLIDED

    >gi|295132997|ref|YP_003583673.1| carboxymuconolactone decarboxylase family protein [Zunongwangia profunda SM-A87]
    MINQVDEFNSYRQKMNDKILGENNKVLKRIFNLDTNAFAEGALDKKTKELLGLVASLVLRCDDCVKYHLESSFNEGLKRE
    EVMETLSIGTLIGGTIVIPHLRRAFEYWESLEQANTEK

    >gi|295133192|ref|YP_003583868.1| ahpC/TSA family protein [Zunongwangia profunda SM-A87]
    MQKLILFISILLLIINVGCNTPKHNPMDHPVVELSLVSQTPQNKFSFPKLYSTYPVFSTAEISKKYYLEKLENFKGIPKL
    DTFLIQTESFKSGNFFGKIALYSDDNKDLSFYRDSLKMFYDKNSHNLNIISGFRGNKQIIIADLNNNKDFSDDSILSFPK
    NKDESIKNIDSVVEFKYNLNDSVSTNFSKRHIRIFPDSNSIYAKFLKDSLNKSLATSFELMDFMKGQLRIDTLDYDIAIQ
    GFVKNRTLILVKPINISLSDQDKVFNENFYFSVGDTLILEDNFYKIDSLSDNFRKLYFSLIKNIDVYRGRRLGVKIKNYN
    LTSLTKDTTTIKEFSKGKKFILLDFWGTW
    CVPCLELLPNLKKFHQENDNVSIISIALDESIDVVKDYSEKEAMYWNHAYV
    DRNNRKGIITDLRVESYLTFILLNDKLKILYKGAGETALENIEKILRSKK

    >gi|295133193|ref|YP_003583869.1| thioredoxin family protein [Zunongwangia profunda SM-A87]
    MKQFTSLILLFSVICFAQNKSYSIKGTIKNAASDYLYIIGEDFIDSTKIKDEKFEFKGQFDHPKKISLSTKNTRRSDGIY
    LENSDYEIDLEVSPGDKSMSIIHLTGKSKTQNLKNEFVSFYESNYDQKDFGRKVYNKLDTLISTYPKNPLIGEMLAAIVE
    QGGIISSFEASNLLDKLDLKFQNKSSINDIKVNIKKYEKFEIGSKLPTIILPNENNKMVDISKSNAELTFIEFWFVG
    CTP
    CMEAIPKLKEVYKKFNTENVEIIFIAIQENKESWKNALEKFDMPWQNLICVDKTSNKTIQSLQIQFYPSSFLVDKNNQIL
    GVNLEPIQLKNRLKELLAEKS

    >gi|295133229|ref|YP_003583905.1| ahpC/TSA family protein [Zunongwangia profunda SM-A87]
    MFIIKKIKLPAFLLFSIVLFVSSCNQKPQLYGTPNVDIATIQSQFLNWYRYDKIYIDLSKDYHALNSNSEEISKEEFLEE
    LSMAKYLVVRMNSAENTTFYKLIEIPEDGNKEIGNQLAKKADRELRNLKLLNKPFPDFNLKSLKGNSYQLSQFKDQYLVL
    NFWYTT
    CGKCKKELPDIEALAQKYKYRDIAFLNISLNEVHTLNNYLDGKNYQVETLPMNKKYVLDSLSIRLFPTYLIIDP
    NKKVINVSNNSRQLEKRVKEIIDELN

    >gi|295133299|ref|YP_003583975.1| Predicted dithiol-disulfide isomerase [Zunongwangia profunda SM-A87]
    MHCGKVVVNFPPGKITSGKLKRFMKVSIWSDVRCPFCYIGKKKFEDALEKFSNKHEVVIVWKSFQLDPSLKTDTHTSMLD
    YFVKTKGVSEEQAMQMFSGATKMAEETGIAMNIQKGILANSFNAHRLIQFAKTRGLGNEVKEALFKIHFEEGKNIDDISI
    LSEVAVSIGLDAEEVKQVLKSDDFAYEVKQDEMEARNIGVRGVPFFVFDDKYAISGAQPVEAFLQTLEKVWEENKSELKI
    SEGDSCSSEGNCD

    >gi|295133378|ref|YP_003584054.1| putative lipoprotein/thioderoxin [Zunongwangia profunda SM-A87]
    MKKILFLSLAFLIFSCKSELKKENNDLADFNLYLQTKEEIDTIMITDISQNREVHKIAYKDTIKINFKDSINDLYNVWFF
    KNGKMVSSPMQYSQLWLNGKNIEIKGTIDKKLIIDTIIGSDLYYNTKRYQTEYKSLYKTNADSSEINTFLLKNIQDNFDN
    PFSLPIMSTYIFRNQNNKSKLKELHQLVNKQSDLLKNHSFFNYHKELEKKLRITELDIHSFSFYNLKNDIVKLNFVKDKT
    YLIDLWFAN
    CPPCVKDHKVISKKLNFLENNNIELIGISIDKEHSKWKNYLKTNQYNWKNVRQIDSLKTITQELGISAFPT
    YLLIDNGREIKITFNAFEEIENYLTEK

    >gi|295133445|ref|YP_003584121.1| putative glutathione peroxidase [Zunongwangia profunda SM-A87]
    MMMKKILLVLALIFGTTLIAQNNKTIYQFKVEDINGETFDFSSLKGKKIMIVNTASKCGFTPQYAELQHIYEQYKYKDFV
    IVGFPSNDFGNQEPGSNEDISEFCQQNYGVEFPMMSKIKVKGDEKHPLYQFLTEKAKNGFKDSEVKWNFQKYLIDQNGRV
    VAVKNSNVLPNDSEIVNWIQE

    >gi|295133594|ref|YP_003584270.1| AhpC/TSA family protein [Zunongwangia profunda SM-A87]
    MRKLIGIASLLVILTGCEKDQGFSISGKAEGIENGKKVYFSELKELNQRPERIDSTTIENGKFEADFADIESPNLGYLEV
    EGINGMVLFITENENIDFTIYKDSIQASKRKGGKQNELLNEYMENMQSINKEVSKLRMEMQTAYQSQDSTKLETLQNTQT
    EIMDNDKLFKKQIAKENKDAFVSVMALVDLLRMQGISVKELKETYDSLDEEVKNTALGAMLGKQLESMSATEIGSEAPDF
    SGPTPEGEELSLENAMGKVTIIDFWAAW
    CKPCREENPNVVKVYNKYHDKGLNIISVSLDKPNEKDKWLKAIEDDGLVWNH
    VSNLKFWDDPIAKKYGIRAIPATFILDENGVIVDRDVRGEEALDKRIGELLEGKK

    >gi|295133644|ref|YP_003584320.1| metallo-beta-lactamase superfamily protein [Zunongwangia profunda SM-A87]
    MKIEQIYTGCLAQGAYYIESKGEVAIIDPLREVQPYIDKSEAAGSKIKYIFETHFHADFVSGHVTLSEKTGAPIIYGPNA
    NPNFESITAKDGQEFKLGELTFVVLHTPGHTMESTTYLLRDKNGKDHALFTGDTLFLGDVGRPDLAQKAAHMTQEELAGT
    LYDSLRNKIMPLADDITVYPAHGAGSACGKNMMKETVDTLGNQKQMNYALRADMSKEEFIKEVTDGLLPPPAYFPMNVKL
    NKEGYKDIDDVIAQGENALSPDAFEAAANETGAVMLDTRHQNDFAKGHIPGSIFIGIDGSFAPWVGDLIKDVQQPILLIA
    DKDRIEEVITRLSRVGFDNTMGYLDGGFEAWKKASKEYDTVTSIPATEFKQIEDDSNNDVPVFDVRKSGEFQSEHVVNAN
    HTSLSEINDHLAGYPDNETFYVH
    CAGGYRSMIAASILKSRGIHNLIDVQGGFKAIKEAGVETTDYVCPSTLK

    >gi|295133646|ref|YP_003584322.1| antioxidant, AhpC/TSA family protein [Zunongwangia profunda SM-A87]
    MENTIENGVTSMPRIGDEAPDFKAKTTKGDIQMADFAKDKWIVMFSHPADFTPVCTTEMSGFATRKEEFDALNTELLGLS
    IDSIHAHLGWVANVREKTGVYFDFPIIADIDMKVSKLYGMLQPNESETAAVRAVFFIDPKKKIRLIMYYPLNVGRNMDEI
    LRSLEALQTSDKHGVAMPLDWKKGDKVIVPPPKNLEEMEARIADDSCEKVDFYLAKKFL

    >gi|295133647|ref|YP_003584323.1| rhodanese-like protein [Zunongwangia profunda SM-A87]
    MSTLSGANAQQNDTLKILTASEFNEAIKNNNVQLIDVRTAKEFSEGAIKNALNIDFFQQETFNKEFGKLNKEQPVYLYCR
    SGNRSQQAARKLDSLGFKKIYDLKGGYMGWPYKK

    >gi|295133648|ref|YP_003584324.1| rhodanese-like protein [Zunongwangia profunda SM-A87]
    MYQTNMKTLLTIFAVTLFALTTAAQKPVDNPEYQKMLDTLLTHSVNEISPNEVQPNKDVIFLDTRAKKEFKVSRIDGAIW
    VGFLSFNKRRVKEIPKDKKIILY
    CSVGYRSEKIAEKLQEEGFTDIHNLYGGIFEWLNKGKIVVNDKGPTQEIHPYNKHWG
    QWLDKGVKAY

    >gi|295133660|ref|YP_003584336.1| Rhodanese-like protein [Zunongwangia profunda SM-A87]
    MNIKQFEYKPLAHYSYAIASEGKVAIIDPERDPSQYYAFAKANNAEIVAVIETHPHADFVSSHLEIHKKTGATIYNSEKL
    GADYPHQSFDEGDEIRLGKISLKAINTPGHSPDSITIVATEGEDTALFTGDTLFIGDVGRPDLREKAGNMQAKREELAEM
    MYDTIQNKFTDLPDDAVVYPAHGAGSLCGKNLRDANSSTLGNERMGNWAFKEQSKKEFMDTILDGQPFIPSYFGFDVDIN
    KAGAADLQPSIEDIPFTEKTTAEGLIVDIREEATFKKGHLKGSINIQANSENAKFETWLGSIVEPKEAFTLVIDSAENKD
    ILLHRVAKIGYEKQLTKVITLANENLVKTEKLDLADFKKNPDNYTIVDIRNTSEVEEGKFFDSAVSHPLNELRETADEIP
    TDKPIVVH
    CAGGYRSAAGSSILQKKIKGTIVYDLSEDINDFKN

    >gi|295133665|ref|YP_003584341.1| thiol:disulfide interchange protein DsbD precursor [Zunongwangia profunda SM-A87]
    MYGVSIIAIYTIVGTLFSVLFGADFANFLSTHWIPNLFFFAIFIIFALSFFGLFEITLPNKFVNKIDSKSNKSGVLGIFF
    MAFTLVLVSFSCTGPIAGTILLQAANGDTIQPIVGMLGFSLAFALPFTLFAVFPNWLKSLPKSGGWLDTVKVVLGFIELA
    LALKFFSIVDQVYHWDILNREVYLALWIVIFAFLGFYLLGKITFPHEQKQQKTSVGRIISALLVFSFVVYLIPGLVGAPL
    KALAGYMPPLSSQSFVMNSPQVTSISNNTMKTAECGVPKYGDLLELPLGIQGYFDYTQALECAKKQDKPLFIDFTGHG
    CV
    NCREMEATVWSDPKVLKRLKEDYVVVALYVDEKTELPEKEWYVSAHDERLKKTIGGQNLDFMIQRLNANAQPYYTLVDTN
    GSLLNAPKGYDLSVQNFVEFLDNGLEEFKIRNTKDVLVNSDSEGVNHNPIIN

    >gi|295133667|ref|YP_003584343.1| thioredoxin, putative [Zunongwangia profunda SM-A87]
    MMEENQKDKNIKKTWIQYGIFAIVAITLYATGLHTEVIGFVQRGLLATGFMNPDVEVIAQNNSDVETVESSAFAKADYNL
    KLRDAKGNVVSLEKYKGKVIFLNFWATW
    CPPCVAEMPSIEKLYKDMGNDVVFVMLSFDKNFETAKAYMERKDYGLPIYEQ
    AGPMPAVYESTALPTTYVIDAEGNIALTHKGMADYNNEEFREFLNSLK

    >gi|295133671|ref|YP_003584347.1| yeeE/YedE family protein [Zunongwangia profunda SM-A87]
    MNWIYEPWPWYVAGPLIAFVMLVLLLVGKQFGMSSNLRTACAALGAGKAADFFKFDWKAERWNLMVVLGAIIGGFLASNY
    MSDNTVEINPEIAQQLSDDYQINSAGESYLPPEIFATDALSDPFIIVVLLIGGLLVGFGARYAGG
    CTSGHAISGLSNLQL
    PSLIAVIGFFIGGLVMIHLIYPLIF

    >gi|295133719|ref|YP_003584395.1| dihydrolipoamide dehydrogenase [Zunongwangia profunda SM-A87]
    MSKYDIIVLGSGPGGYVTAIRASQLGFKTAIVEKENLGGVCLNWGCIPTKALLKSAEVFEYLKHAEDYGLKLQSPDKDFG
    AVIKRSRDVANGMSKGVQFLMKKNKIDVIDGYGKLKAGKKVEVTDAKDKKTEYSADHIIVATGARSRELPNLKQDGKKVI
    GYREAMSLDKQPKKMIVVGSGAIGVEFAHFYNSMGTEVTIVEFLPNLVPLEDEEVSKQFERSVKKAGIKVMTNSSVESVD
    TSGDGVKAKVKTKKGEETLEADIVLSAVGIKTNIENIGLEELGIKTDKDKIVVDDFYKTNKDGIYAIGDVVHGPALAHVA
    SAEGIICVEKIKGMNVQPLDYGNIPGCTYATPEIASVGMTEKQAKEAGYEIKVGKFPFSASGKAKAAGKSDGFVKVIFDA
    KYGEWLGCHMIGAGVTDMIAEAVLGRKLETTGHEVLKTVHPHPTMSEAVMEAVAAAYDEVIHI

    >gi|295133721|ref|YP_003584397.1| peptide methionine sulfoxide reductase [Zunongwangia profunda SM-A87]
    MKKYNIEKPEAEWKEQLSEEQYRVLRKKGTEAPHTGKYNLHFEDGEYRCAACNEKLFESDSKFESGCGWPSFDEAIEGKI
    EYVQDRTFGMIRTEILCANCGSHLGHVFDDGPTETGQRY
    CVNSASIDFKNN

    >gi|295133722|ref|YP_003584398.1| peptide methionine sulfoxide reductase [Zunongwangia profunda SM-A87]
    MFTLVSCKGNAQDENSKKKQKFEISKSESEWKKELTDAEFKVLRKAATERPYSSDLLTVKGNGTFVCAACGNELYENKHK
    FESGTGWPSFDRAIEGGVAFGSDSKLGYQRDEVHCAKCGGHLGHVFDDGPRETTGKRH
    CINGVAMNFIPTEK

    >gi|295133745|ref|YP_003584421.1| OsmC family protein [Zunongwangia profunda SM-A87]
    MKTQYQTTVSATGGRNGHVKSEDGLIDFDILMPKELGGKGGTTNPEQLFAAGYAACFDSALNMVIGKAKVKPEKETTVTA
    IVGIGPNNEGGFQLAVKLSIEIPGVEKEKAQELVEKAHQV
    CPYSNATRGNIEVELEVI

    >gi|295133765|ref|YP_003584441.1| Thioredoxin Disulfide Isomerase [Zunongwangia profunda SM-A87]
    MKKILLILICVFSTQFLLAQDWKTDFAAAKKEAAKEDKPIILVFQGSDWCAPCIKLDKEIWSTEEFKDYAQKHYVMLKAD
    FPRKNKNALSPEQQEKNNKLAEVYNSNGYFPFVVVLDKSGKVLGQAGYQKIEVKQYIAMLDKFAK

    >gi|295133841|ref|YP_003584517.1| metallo-beta-lactamase/rhodanese-like domain-containing protein [Zunongwangia profunda SM-A87]
    MIIEQFNDEALAHYSYAIVSEGQMAIVDPSRNPMPYYVFAEAHNAKIVAVFETHPHADFISSHLQIHEETTATIFVSKLV
    GADYDHKSFDEGDSFQLGKVNFSALNTPGHSPDSITVVAKEGEETALFTGDTLFIGNVGRPDLRENAGNMKAKRIELAKD
    MYNTMQTKFNDLPDDALVYPAHGAGSLCGKNMSSDSSSTLGNERMGNWAFKEQSEEEFVEEILKDQPFIPSYFGFDVDVN
    KTGALNVQKAKYNVPIFLNVDEVEEGLMIVDTRGGDDFKKSHLPGSINIMATSPKQKFETWLGAIIQPEEDYYLVVPSVE
    NIDALLERVAKIGYEKQLKAVITLAENLEGSMEFLEVEDFKEHPSEYTIVDIRNASEVAEGKFFESAIAIPLNELRNRTD
    EIPTDKPIVVH
    CAGGYRSAAGSSIIDEQLSVATVFDLSDAVKDFK

    >gi|295133889|ref|YP_003584565.1| thioredoxin-like protein [Zunongwangia profunda SM-A87]
    MKQLLCILLIFLFFNAVSISAQEKKTDSIKDKVLFTEALALHLADYNEKADFAYRQRNFKKAQHLFDSITVNHLTGSYIN
    NFKFHNLRGKEVYLYDFDKSIYLITYASW
    CIPGKGAIPAINEIAKKYKDQIQIIILFWDTRDKVKKVSKEFSNTVNIVYV
    DETQNKSPYVVKQLKHSLGLPTCFLINKDKRIEDITRYTAVAYGTPIENALKKNFNQIDEGITSHLINSEDTKVIKSQLA
    SGKDKKE

    >gi|295134045|ref|YP_003584721.1| alkyl hydroperoxide reductase, F52a subunit [Zunongwangia profunda SM-A87]
    MENKKFEVIIIGGSYAGLSAAMALGRSLRKVLIIDSGSACNRQTPHSHNFITQDGVPPAKISEKAKNQVLQYKSVAFIND
    LAIKAEKTENGFNVDTQSGEKLVTSKIIFATGIKDLVPPVPGFKECWGISLIH
    CPYCHGFEFRTKKTGILANGERAFHLA
    SLVSNLTNDLIILTTGKADFKPEQFAKLEAHRIPIIETEIAALEHQEGQVKNIVFTNGDREIFDALYAGFPFKQHSDIPL
    FLGCELTEQGYIRVNEFQQTTIDGVYACGDNTSRMRSVAAAVASGNLAGAMTNAALTKELF

    >gi|295134176|ref|YP_003584852.1| arsenate reductase [Zunongwangia profunda SM-A87]
    MITIYHNTRCKKSREGLQLVENSGKEFHVREYLKEPLSEKELKALLTKLNMTAIQLVRKNEKIWKENFKDKDLSENELVR
    IMVENPKLIERPIVENETKAVVGRPPEEINNLV

    >gi|295134183|ref|YP_003584859.1| ahpC/TSA family protein [Zunongwangia profunda SM-A87]
    MKNVLPRKDAPQLSVQTTKGVRWNLEDEKPENFTMLVFYRGIHCPVCKKYLTELNSKISEFDERGIEVVCISANTEELAK
    KTVESWDIDKLNIAYGLLTEDARKWDLYISEGINDKEPEAFFEPGLFLIKPDNTVYAASIQSMPFARPNFDEVLKAIDFV
    LDKNYPARGEA

    >gi|295134200|ref|YP_003584876.1| peroxiredoxin Bcp [Zunongwangia profunda SM-A87]
    MTTLKTGDKAPDFAVEDQDGNLIKLSDFKGKKLVLFFYPKASTPGCTAEACNLRDNWEVFKEKGYAILGVSADSKRRQTN
    FKAKNELPFPLLADEEKKVINAYGVWGPKKFMGKEYDGIHRTTFVIDEEGKIEEVIGKVKTKDHAAQIL

    >gi|295134239|ref|YP_003584915.1| yeeE/YedE family protein [Zunongwangia profunda SM-A87]
    MLQAVFLISGLFVQNKNMNWILEPWPWYVSGPLIALTMFLLIFMGRQFGMSSNLRTMCSMCGADRKADFFDFDWKAQQWN
    LLVVLGAVIGGFIAHFYLSDAPTTVAISSETIQDLNNLGFESAGNAYLPTELFSTSVFSEPLTIVLLLIGGVLIGFGARY
    AGG
    CTSGHAISGLSNLQIPSLIAVIGFFIGGLVMIHFLYPLIF

    >gi|295134242|ref|YP_003584918.1| thioredoxin reductase [Zunongwangia profunda SM-A87]
    MSETIEKIKCLIIGSGPAGYTAAIYAARADLKPIMYTGMEPGGQLTTTTEVDNFPGYPEGIDGPAMMMDLQKQAERFGTE
    VRMGMVTEVQFSKEVGGIHKACIDNSKWVEAETVIISTGATAKYLGLPSEQKLRGGGVSA
    CAVCDGFFYKNQDVAIVGGG
    DTAAEEATYLANICKKVTMLVRKDEMRASKAMQHRVNNTKNLEVRYNTEVDEVIGDQVVDGLRMVNNKTGEKEEIAITGL
    FIAIGHKPNTDIFKGHLDMDDTGYLITKGKSTKTNIPGVFASGDVQDKEYRQAITAAGTGCMAAMDAERYLAEIETSEEE
    EKEVTA

    >gi|295134389|ref|YP_003585065.1| peptide methionine sulfoxide reductase [Zunongwangia profunda SM-A87]
    MKKEETATLAAGCFWCTEAVFQRLEGVSNVISGFTGGEIKNPPYREVVTGRTGHAEGIQFNYDPKVISFQELLLIFFSTH
    DPTTLNRQQNDVGTQYRSAIFYHSDAQKQIAEQVIKELEAQEVFKDPIVTEVTEASAFYKAEEEHHNFYNQHSSQPYCQY
    IIDPKIHKLRSLFADKLKK

    >gi|295134398|ref|YP_003585074.1| thioredoxin-like protein [Zunongwangia profunda SM-A87]
    MEKIMKKLLYILIILLLGCVPEKENFQEMTIQGKITGKIPERIEYTIPINGISYVGFENAVQPDSLGNFTISLVIDKASF
    IELSDGHKAYGTIIAEPEMNYDVSIAVEEKKNKFTIKGPNQKGQDLYNQNPNRSLLTGHFEVEATKYSKDSIPKRIKQNL
    EESREHTLKTYNDLLSDNLISKEFYELVSIDQHYFYAGAQTSIALLNYLLSERKMNFLTEEEYTDLWEEAFQSNPVSNPA
    LMRSPWFFYYVKSYLWYKDLVEDNIKPEALLKIKKQELPHTYHIELAKTYLAGKQLEYYYAAYLYMEAISQNYEKELVRL
    FELFKEAYPSSEYTQFIASEIIPIIAFHRKQDEELNEHTYILENPKDINSLKDAVHKLNAQRVYVDIWATW
    CAPCKKEFE
    YNSRLYQLLENEDTAMLYISVDKDDRAEKWMEMIKYYQLEGYHIRANEKLYEDIKRLRGEDRFGIPWHFLMDGEGNIIQK
    YMSGPSEINTLKKQLQGN

    >gi|295134412|ref|YP_003585088.1| OsmC-like protein [Zunongwangia profunda SM-A87]
    MIRKASAVWNGTLKEGHGKLSTESGVLNETQYSYKTRFEDGKGTNPEELIGAAHSGCFTMQLSAFLAEEDFPAETLNTKS
    EITFKDGVVSKSHLILEGKVPNISEEKFLEIAKKAKEN
    CPLSKLLDTEITLDAKLVK

    >gi|295134679|ref|YP_003585355.1| putative exported cytochrome C biogenesis-related protein [Zunongwangia profunda SM-A87]
    MNKFIALAVLLFAILPLKAQVFDPSMAGGGGQFENPVNWEASFEKENDSIYIIKIKAELEGNWHLYSQKEVEMDIAPIPT
    QFTFNVEEEEYELIGETLEPEVEPVYDEVFEANITYFEEEAEFTQKIKVVNPEDTQVVVEVYYSVCDDKQCLPPETERFT
    LSLGSNKVTQGFTDLTIEDEDQSLAQQLDIKVQGWEGYETEKEESSYLSIFFLGFVGGLIALLTPCVFPMIPLTVSFFTK
    GAQTRSKGVTNAILYGFFIFLIYVLLSLPFHLLDSVNPELLNNISTNVTLNVIFFVIFIVFAFSFFGYYEITLPSSWGNK
    LDDKASSIGGIIGIFFMAVTLAIVSFSCTGPILGSLLGGSLSSDGGATLLSIGMGGFGLALALPFALFALFPNWLNSLPK
    SGGWLNSVKVVLGFIELALAFKFLSNADLVDHWGILKREVFLGIWIILGIGLTLYLFGVIRFPHDGPKQKISKARFGLGI
    LSLLFVLYLIPGLTNTSYSNLKLLSGFPPPMFYSLYDKDTGGPMGLESYHDFEEGVKAAKEQGKPIIIDFTGWA
    CVNCRK
    MEEQVWTDPEVYDILKNDYILISLYVDDKEELPEDKQFNYERPDGSIKKIKTVGDKWATFQTLNFKNNSQPFYVLLDSNF
    NLLNKPTGYTPKVSEYISWLENGLQKTEELAKK

    >gi|295134691|ref|YP_003585367.1| dihydrolipoamide dehydrogenase [Zunongwangia profunda SM-A87]
    MSTYDVAVIGSGPGGYVAAIRCAQLGMKTAIIEKYSTLGGTCLNVGCIPSKALLDSSHHYHDAVKHFEDHGIEISGEVKV
    NLEKMMDRKASVVSQTCDGVKFLMDKNKIDVFEGIGSFKDKTHINIEKNDGETETIEAKKTIIATGSKPANLPFIELDKE
    RVITSTEALKLKEIPKHLIIIGGGVIGLELGQVYKRLGADVSVVEYMDRIIPTMDSALSKELTKVLKKQGVKFYTSTKVK
    SVERNGDEIVVKADDKKDKEVELKGDYCLVSVGRRPYTDGLNADAAGVEIDDKGRIAVNEHLQTNVENIYAIGDVVKGVM
    LAHKAEEEGSFVAEVIAGQKPHINYNLIPGVVYTWPEVASVGKTEEQLKEDGVKYKEGKFPMRALGRSRASGDIDGMIKI
    LADEKTDEVLGVHMIGARTADLIAEAVTAMEFRASAEDIARMSHAHPTYAEAVKEAALAATDNRAIHV

    >gi|295134694|ref|YP_003585370.1| peroxiredoxin [Zunongwangia profunda SM-A87]
    MSIVGKKFPNLSVNAMNDLGDTFKLNVLEEAQKNNKKVLLFWYPKDFTFVCPTELHAFQAALEEFEKRNVMVIGASCDTP
    EVHFAWLNTPKDDGGIEGVTYPILADSNRNLSSRLGILDITGESYDEETGDITLEGDNVTYRATYLIDEEGTVFHEGVNH
    MPLGRNVQEFLRLIDAYTHVQKNGEVCPANWEEGKDAMKADRKGVADYLSLN

    >gi|295134695|ref|YP_003585371.1| thioredoxin [Zunongwangia profunda SM-A87]
    MMKTLDQDNLNEIVSSNETVVVQYMAGWCGNCRLMKPKFKKLSGENENVEFILVDAEKYPESRKLANVNNLPTFATFKNG
    EFVNQVQTNKFDVLKDLVNEVTSN

    >gi|295134697|ref|YP_003585373.1| thiol peroxidase [Zunongwangia profunda SM-A87]
    MSEISFKGERVITYGDLPAIGEKAPHFDLIKTDLSKAKLEDFKGKRVILNIFPSIDTGVCATSVRNFNERATELDNTVVL
    CISRDLPFAQKRFVNDEGLKNVINLSDFKEREFGKDYGVEMITGPLEGLLSRVVIVLDENLNVIHTQQVPDIAEEPNYLA
    ALKTLL

    >gi|295134744|ref|YP_003585420.1| short-chain dehydrogenase/reductase [Zunongwangia profunda SM-A87]
    MISYEEASEDVKAIYDDTKKTLQLPFVLNWFKCQGSNAILLEGNWNKLKNTLIKGNVPNVLKQLIIYNVSKSRGCNYCSH
    AHGIFADSMSSMISEEEGFKATEHIDSPSMPASYRKAVNVVTKAALQHSEISDEDFAELEAVGFSNAEIQELMAQADLVN
    MLNTIADVSGIKIDNELLETPE

    >gi|295134820|ref|YP_003585496.1| rhodanese-like protein [Zunongwangia profunda SM-A87]
    MNPKRYTRQTRLQGFGEAGQQKLAAAKVLVIGAGGLGVPVLQYLSGMGVGTIGIVDNDVVDLSNLQRQILYAENDIDQPK
    VKVAKQKLEALNSEIEIIPFYTFISTENALEIITDFDVVVDASDNFPTRYLVNDACVILKKPLVYGALHAFEGQVSVFNY
    QGGPTYRCLFPEMPNPEEIPD
    CNENGVLGIIPGIIGSLQALETVKVITGIGETLSGKLLLFDGLSQSQQKIKFGLNPHHL
    KIKELQKSYEFSCATEVKSIEAEDFLEKWKGEDIQLIDVRNPEEVERQNLPETIQKDWKNIPLNKLQRESSKINLQKPTY
    FL
    CQSGIRSIKAIRLLEGLGIQGEFIDIKGGISAISTIAATTKHA

    >gi|295134858|ref|YP_003585534.1| metallo-beta-lactamase superfamily protein [Zunongwangia profunda SM-A87]
    MKVEQIYTGCLAHAAYYIESKGEAAIFDPLREVNPYIQKAENDHAKIKYVFETHFHADFVSGHLDLQKKTGAKIVFGPNA
    KPGYEALVAEDGQIFKIGDYKVKVIHTPGHTMESTTYLLIDDKGNEHGIITGDTLFIGDVGRPDLAQHVISDLTEDKLAG
    YLFDSLRHKIMPLDDDLIVYPNHGAGSACGKKMSKETTDTLGNQKKTNYALRADMTKEEFIKELLTGLTAPPKYFPKNVL
    LNIGGYKSFDKIMKQAAKALTPDEFELLANEEGALVLDTREADKYAKSHIPNSINIGLQGSFAPWVGEMIPDLETPILLI
    TEVGKEEEAITRLSRVGYDNTQGYLADGMKSWEAVGKDVDTINRITAEELEQKMKQDIVIIDVRKKSEFDSEHIKGVVNV
    PLNQINQHLEKFPKEQEFVLH
    CAGGYRSMIAASILQQRGWSQLTDVIGGFKSIKETTIPVTAYVCPSTLL

    >gi|295134985|ref|YP_003585661.1| ABC-type transporter periplasmic binding protein [Zunongwangia profunda SM-A87]
    MITIFDHLGRKLILQDTPNRIISLVPSQTELLVDLGLQNCLVGITKFCVHPRNLRKDKTVVGGTKSVHFDKIKALRPDVI
    L
    CNKEENTRDMVTELEKIAPVHVSAVSTIAASLQLIKDYGQLFNVQEKALKLVTCLENEGLTFSEEMQYKNWKRCIYLIW
    KDPYMAAGRDTFINDLLKLNKFENIIANDRYPVIDEEQLVEYSPDVVLLSSEPFPFKKDHLKHIERLGIPAMLVDGEYFS
    WYGSRLKKAFDYFRSLN

    >gi|295135093|ref|YP_003585769.1| redoxin domain-containing protein [Zunongwangia profunda SM-A87]
    MKNYYYILLLLSTFYACKKNPDQKTDEDELKPVVMVDELLSNQDKWWTYQYNRISLSSDFEPIDTSFNVIPKGKFLWELT
    SGNFVPIEMESDSLKTYKLYAIPTQSKNEISQIIKNLAKSEFQFYLMEGKPFPEFKAKNMEGEVIDQNNLIGKTTVLKTW
    FIN
    CKACIKEMPELNKLVDRYENENIQFISLALDEKKDLEKFLEKTEFNYAVLPEQKDLIQEALKLNAYPTHIVVNKSGK
    IVKVLSKGSDLIAYVKEFMKNPDKELEVNSIPPPPPPLP

    >gi|295135132|ref|YP_003585808.1| putative lipoprotein/thioderoxin [Zunongwangia profunda SM-A87]
    MQRFLLIIICFYSLNLSAQQNKFSLTGKTSNIEDGTYLFLRDLVTGKFIDSTKVENNNFTMNTKLEESMMYSMLFTKDKK
    NFKELWIEGSKMTLDASNTNFSDAVVDGSKSQDLSKKIRSEVHANIVDLPQDTIKKREINFIKKYPNSLVSAYFLQGNRR
    MTHQEIKELYLTLSTDVRDSALGQKIANFLEKDMPGIGEKYKDFQVPNKKAELQKISDLTGKLTLIQFWSST
    CEGSLKMN
    TTLKKVYDKYHSQGLNIISISKDNSKTNWINEINEDNLSWSQLSNLEGWEGEVFKAYGISSIPSNVLIDKNGIIISKNLM
    SNELENKINQNLN

    >gi|295135206|ref|YP_003585882.1| putative copper transport-related membrane protein [Zunongwangia profunda SM-A87]
    METINIFETKEKNTKKGIKESFPVTGMTCASCAASVESVLKHTEGVFDASVNFANSSVLVEYDKELSPNQLQNALREVGY
    DIIIDAEDPSEVQQELQQKHYQDIKNRTIWSAILTLPIFVLGMFFMQWEPGKWISLVLTFPILFWFGRSFFINAFKQAKH
    GKSNMDTLVALSTGIAFLFSVFNTFFPEFWLNRGIEPHVYYEAATVIITFISLGKLLEEKAKSNTSSAIKKLMGLQPKTL
    KIIENGEEKEIPISSVQVGQTILVRPGEKIPVDGEVSKGSSYVDESMITGEPVPVQKSQGEKVFAGTVNQKGSFQFTAEK
    VGGETLLSQIIKMVQQAQGSKAPVQKLVDKIAGIFVPVVLGISIVTFIVWMSLGGDNAFSQALLTSVAVLVIACPCALGL
    ATPTAIMVGIGKGAENNILIKDAESLELGHKVNAVILDKTGTITEGKPLVTDIFWKDKLEDINEYKKVLLAIEAQSEHPL
    AEAVVNHLKDENIEKAEIASFESITGKGVKAQTENGSPYYVGNHKLMLEKNIQIDASLMQTAESLEEQAKTVIFFGNEKQ
    VLAILAIADKIKETSKMAIATLQERGIEVYMLTGDNNKTASAVAKQVGITNYQGEVMPSDKAAFVEKLQADGKIVAMVGD
    GINDSHALAQANVSIAMGKGSDIAMDVAKMTLITSDLQSIPKALELSKRTVLGIRQNLFWAFIYNIIGIPIAAGVLYPVN
    GFLLDPMIAGAAMAFSSVSVVANSLRLKRVKL

    >gi|295135207|ref|YP_003585883.1| putative mercuric transport protein [Zunongwangia profunda SM-A87]
    MAITKWNKKTSMGTAVFSAVSLKLCCWGPLLLTSVAGISGSSVYFSWLIALKPYLLVIAFLSLGLAFYQVYKKKKVDDCG
    NCDMAKPSFFKSKFYLWLVTVFVVVMTFVSYYPQIFHSTEKVGIVATNNTDIQTVKLNIEGMV
    CSGCEENINHSVNKIDG
    VTNVSTSFEEGTSIIEFDTTKTNVDEIKKVIQSKGYLITNSRD

    >gi|295135210|ref|YP_003585886.1| putative mercuric transport protein [Zunongwangia profunda SM-A87]
    MKRENKLIGAGLLAAITASLCCITPVLALIAGTSGIASTFSWLEPFRPYLIGLTILVLGFAWYQKLKPQKEIDCECETDE
    KPKFIQSKKFLGIVTVFAIIMLAFPYYSSIFYPNIEKQIIVVDKSDIKTMEFKISGMT
    CASCEEHVNHEVNKLNGIVNSK
    ASYENGNAIIEFDKTKTNEKEIENAINATGYKVTDRKN

    >gi|295135364|ref|YP_003586040.1| AhpC/TSA family protein [Zunongwangia profunda SM-A87]
    MKKILLPTLAVVSALISCESEPEDKGKDIGALHISKEFPKPGDEIKITYASGDSIPSSEDEKVKGIINFITDTGVYPEDI
    ELKDSATMYMSNIKIPDSVKAISFQFKQYNIDENNDKEGYVLPLYDEEGNALTGSAAQIANLYSQGDRYGNIEIPKDSII
    SKFEADFKKDASLEGKWAGNYINLIKSDKEKATAFVEKQMATAFANDSLSEEDYMRLYRMNAMIENKKIADSLRNLIPEK
    FPQGSLATSSYYQKVYEAKGSAEKEKVFQDYEDKIGKENMYRNYMLSMLASEFAADGHIEKAKEYASKISEKGREASAYN
    SIAWKLAEEGKDLGKAQEISKKSLDLIENIDPKEDKPKTQTASQYKSNLDYMKVMYEDTYATIMYKQGDLKEAIKYQEMA
    ANSKTADAEITEKYIQYLVEDKQYETAKEKAASFIAKNKGSQKLNEYYKEAYTAVGDTAGFEKEFAMLEEKGHQKAKSDI
    KKMMIDEDASQFTLKDLEGKKVSLEELKGKTVILDFWATW
    CGPCKMSFPGMQKAVVAHKDNPNVEFLFIDTWESQTPDVR
    MKEVSEFIDANDYDFHVLMDEKVGDGNSFKVVEDYGVSGIPTKFVLGPDGRIKFKSVGWNGNTDKLAEELAIMIQLTQS

    >gi|295135457|ref|YP_003586133.1| OsmC-like protein [Zunongwangia profunda SM-A87]
    MKIFLKRLNDAYHFETKNERGDIVHLDNKSEENPQGGSPMDMLLRGIAGCSSIDVVMILKKQKIELEDLQVEVEGFREDG
    AVPNVFKKIHLNFMLKGDVTPQKALRAVELSMDKYCSVAKMLEKAAEISYEVYVNGEVVK

    >gi|295135458|ref|YP_003586134.1| thioredoxin reductase [Zunongwangia profunda SM-A87]
    MIKTDILIIGAGPTGLFTVFEAGLLKLKTHLIDALPQPGGQCSEIYPKKPIYDIPAFPEINAGDLVNNLMEQIKPFEPGF
    TLGERAETLEKLDDGTFIVTTNKGTKHQAPVVAIAGGLGSFEPRKPPIQNITDYEDKGVEYFIKDPEIYRDKKVVIAGGG
    DSALDWAIYLADVAEEVALVHRRKEFRGALDSVEKVSELSKLGKIEMITNAEVVGLNGENELEQVVIRHKDEARGEEFRD
    VDHFIPLFGLSPKLGPIGNWGLEIEKNAIKVDNSYDYATNIPGVYAIGDVNTYKGKLKLILSGFHEAAIMCQSAYQRIFP
    DKKYVLKYTTVGGVEGFDGSKKEAKKEVVQSIG

    >gi|295135569|ref|YP_003586245.1| secreted protein containing DUF1573 [Zunongwangia profunda SM-A87]
    MKKLALIAILAFVGFNSAMAQKTAKMQFKSETIDYGEIKKGSDGVRVFEFTNTGDIDLVITNVTSSCGCTIPKKPDGPIK
    PGASGKIEVKYDTNRPGPIRKTVTVYSNAEEPTKALKIKGRVLDDETPKTDGGDTDTK

    >gi|295135584|ref|YP_003586260.1| peptide methionine sulfoxide reductase [Zunongwangia profunda SM-A87]
    MKSIFLTAVCILCFACGNNAQNKPATKPEIANAKPVEVPLENGMAKAYFASGCFWCVEAVYESVKGVKEAVSGYSGGHTK
    NPTYEQSNTGRTGHAESVEVIYDPKVVSFETLVKVYFGSQNPTQVNGQGPDHGSQYRSIIFYQDEQQKQTIEKIKAEVAK
    NYDKPIAAEILPFQKFWIAEDYHQDYEKYHPENPYIQKVSIPRINRFKKKFPELLKKEVQ

    >gi|295135845|ref|YP_003586521.1| putative mercuric transport protein [Zunongwangia profunda SM-A87]
    MEPFRPYLIGITILVLAFAWYQKLKPKTQEEIDCACDEDEKPSFFKSKAFLGIVTIFSVLMLAFPYYSEIFYPDNKKDIV
    VVSQSDIQTIKFDVEGMT
    CAGCEESVKHAVNQLDGILDVIPSYENKNTEVKFDNTKTSKEDIEKAINSTGYKVVHK

    >gi|295135849|ref|YP_003586525.1| dihydrolipoamide dehydrogenase [Zunongwangia profunda SM-A87]
    MQKEITLPIQGMTCTGCATGIEKKVKQLEGVIALDVSYPKGEGKFIFDSSTTSQQDIIDNIEMSGQYKASNGQQVSDKNN
    FDLIIVGGGSAAFSAAIKAESLGLKTLMVNAGLNFGGT
    CVNVGCVPSKNLIRAAETAYHATHSNFQGIRPKGVDIDFSQV
    IKDKKDLVAALQQQKYMDVVKDFKNLAMLTGWAEFVDKGTIIVDGKDTYTATNILIATGATTYIPNIEGLNEVGYLTNVS
    LFDLEEKPQSLTIMGAGYIGLEIAMAYNRLGVKVRIIEFTDRPLRSQTKDITDVLEAQMKKEGIEILPNFRAFKFEKQGA
    DTIIHCNCPDGTTTQIIEKGKIVVATGTKPNTSKLGLDKIKMNLSAVGHVLVNEKMETNISNIFAAGDVTQTPPFVYTAA
    TEGSTAVSNAFSLSKTGIDYSSLPWVVFTDPQVAGAGMDEIVAEEAGLPFEVSKLDLSHVPRALAAQDTRGFIKLIRNTE
    TDKLIGARVIAPEGGELIQQLSMAIKFGITVKDLAESFYPYLTLGEGIKLAAITFGKDVSKLSC
    CAS

    >gi|295135852|ref|YP_003586528.1| glutathione reductase [Zunongwangia profunda SM-A87]
    MKKYDVFVIGSGMSGMTAANKCASKGLKVGITDELPYGGTCALRGCDPKKVIIGATEVRDFAERLKGNGIDTVPKVNWED
    IMAFKQSFVDAMPPKIEKGYKNKDIDTYHTSAKFLSDNTLELGDEVIEADKFVIATGAKPRVLDFEGGNLALSSTDFLNL
    KKLPESLLFIGGGYIAFEFAHIAARAGADVTILHRGDHPLENFDHDIVQHLVNATRNLGIKLVLETEVSKIEKKEDHYVV
    TGKSNGKEATYKTDSVFNSAGRPPAIFDLDLEKAGISFSKKGIAVNEYLQSTSNANIYAAGDSADSRGLPLTPVAVMEGH
    VVASNIIKGNKKKVNYPPMPSVVFTLPTLASVGLTEAEAKSKQIEYQVNYNHAESWFNAKRLNVKEYAYKTIIDKENQTI
    LGAHLIGPNTEETINLFAMAIKTKMKINELRTMIFTYPTLSSDIPHML

    >gi|295135855|ref|YP_003586531.1| hypothetical protein ZPR_4031 [Zunongwangia profunda SM-A87]
    MKRQIEIFTANCPVCDPVVKMVKELSCDSCEITTYNLVEQCEDKTCIDKVQEYGVKRIPAVAVDGKLLECCTNNGISKEK
    LIEAGIGKAS

    >gi|295135864|ref|YP_003586540.1| heavy metal transport/detoxification domain-containing protein [Zunongwangia profunda SM-A87]
    MFGIISSNAQITKVDQEVFGMDCAPCAYGLERGLKKMDGIEKVQVSLNEGKAYLDLTANNNLSLKQIQEEVKVNGFSAKN
    AEIVIKGNFVEQDGTYAIQTGKETFKIAEATSTNLRSRLKPGVLTVKGIVQDEEDGELTTKWEIELTEIL

    >gi|295135888|ref|YP_003586564.1| dihydrolipoamide dehydrogenase, E3 component of 2-oxoglutarate and pyruvate dehydrogenase complexes [Zunongwangia profunda SM-A87]
    MDKYDLTIIGSGPGGYVCAIRAAQLGFKVAIIERYNTLGGTCLNVGCIPSKAWLEASEHYYKLKHQFENFGIDVKEANVD
    ILKMNQRVQDVVQEIINGVDYLMKKNKVAVYQGHGTIKDKNTIEIKGGDKTETITTDKIIIATGSKPASLPNIKIDKKRI
    ISSTEALALQEIPKHLMVVGGGVIGVEIGSVFARLGSKVSIVEYFDSLIATMDGALGHQLHRSLRKQGIDFYLEHKVTNA
    TATEDKVELKAENLSDKEEMSLDGDYCLMAIGRKPYTASLGLENIGVETNEKGQITVDKNLETNVKGVYAIGDVIRGAML
    AHKASEEGVFVAESIAGQKPHINYSLIPNIVYTQPEVAGVGLTEEELKKTNRSIKTGSFPYKANARAKISMDTDGFIKVI
    ADKETDEILGVHMIGPRIADSYTEAVVAMEFRAAAEDIARMSHGHPTFSETFKEACLAATEDRALHI

    >gi|295136011|ref|YP_003586687.1| carboxymuconolactone decarboxylase family protein [Zunongwangia profunda SM-A87]
    MSKTYYDPADLRKFGEITEWSEELGKKFFDYYGKVFEEGALSAREKSLIALAVSHVVKCPYCIDAYTKDGLQRGITKEEM
    MEAVHAGAAIESGATLVHGVQMMNKYKKLSM

    >gi|295136012|ref|YP_003586688.1| radical SAM superfamily protein [Zunongwangia profunda SM-A87]
    MMSLKSLKAREDDLSSPQRQLELLSEGIFEEGELPTFKDKIAESGHFPLKPKKLEILQLNLGYMCNQVCSHCHVDAGPDR
    KEIMTKETMLLCLEVIKNTGAHTLDLTGGAPEMNPNFRWFVEEASKAGIKDFIVRSNLTIILANKKFHDLPNFFKKHNVH
    VVSSLPFYKREKTDKQRGNGVFDKSIKALQLLNEVGYAQPDSALKLDLVYNPSGAFLPTNQAAMEHDFKKALKEDFNIDF
    NNLFAITNLPISRFLEYLIASENYEDYMYSLVDAYNPAAVENVMCTNTISISWDGWLYDCDFNQMLDLKVNSKVKHINEY
    NEDLLNDRNIIISQHCYGCTAGAGSS
    CQGSTI

    >gi|295136015|ref|YP_003586691.1| protein containing methyltransferase domain [Zunongwangia profunda SM-A87]
    MSNYLETTKDVYKDAALTPDVGLCCTTNPIWELPGLKIPKIMQEMNYGCGSTVHARDLSNNPRILYVGVGGGMELLQFAY
    FSRQPYGVIGVDAVDEMLEASRKNFKIAKEQNEWFNPDFVDLKKGDALHLPVKDNSVDVAAQNCLFNIFKAEDLKRAIEE
    MYRVLKPNGKLVMSDPTCEQQMNEELRNDERLRAL
    CLSGSLPIKDYVKALTDVGFGTIEIRARKPYRILDPKHYPTKELI
    YIESIEVAAIKDPMPEDGPCIFTGKAAIYYGESDHFDDKKGHILLKNQPLAV
    CDKTAKALKDLERDDIFISESTFHYDGG
    GCC

    >gi|295136057|ref|YP_003586733.1| putative copper transport-related membrane protein [Zunongwangia profunda SM-A87]
    MNTIMETINIFETKEKKQKQGIKESFPVTGMTCASCAASVESVLKHTEGVFDASVNFANSSVLVEYDKALSPNQLQNALR
    EVGYDIIIDTENPSEVQQELQQKHYQDIKSRTIWSAILTLPIFVLGMFFMQWEPGKWISLVLTFPILFWFGRSFFINAFK
    QAKHGKANMDTLVALSTGIAFIFSVFNTFFPESWLSRGIEPHVYYEAATVIITFISLGKLLEEKAKSNTSSAIKKLMGLQ
    PKTLKIIENGEEKEIPISSVQVGQTILVRPGEKIPVDGEVSKGSSYVDESMITGEPVPVEKSTDEKVFAGTVNQKGSFQF
    TAEKVGGETLLSQIIKMVQEAQGSKAPVQKLVDKIAGIFVPVVLVISIITFIVWMSVGGDNAFSQALLTSVAVLVIACPC
    ALGLATPTAIMVGIGKGAENNILIKDAESLELGYKVNAIILDKTGTITEGKPLVTDIIWKNNLENQNEYKQILLAIEAQS
    EHPLAEAVVNHLKDEKVEQAEIASFESITGKGVKAQSENGSKYYVGNHKLMVEKNIEIESSLMQTAESLEEQAKTVIFFG
    NEKQLLAILAIADKIKETSEKAIVTLQERGIEVCMLTGDNNKTASAVAKQVGITNYQGEVMPSDKAAFVEKLQADGKIVA
    MVGDGINDSQALAQANVSIAMGKGSDIAMDVAKMTLITSDLRSIPKALELSKRTVLGIRQNLFWAFIYNLIGIPIAAGVL
    YPVNGFLLDPMIAGMAMAFSSVSVVLNSLRLKGVKL

    >gi|295136178|ref|YP_003586854.1| thioredoxin-like protein [Zunongwangia profunda SM-A87]
    MNIISGFKGNEQIIIADLNNNKDFSDDHIFEFSKEEKKLIKNKDSVVEYKYNSKGSISNQVFKRDIKIYPDPNSFYAQFL
    KDSLNKSLATSFELMDLRKGQLKIDTSIYDVAMQGYVKNRVSISVKPISVLFSDQDTGFNENFYYSVGDTLLLANDFYKI
    DSVSNNLSKLHFSLIKNIDEYRGKRLGVKIKNYNLTSLTNHTTTIKEFSANKNFILLDFWGTW
    CVPCLKSLPNLKKLHQD
    NEDVAVISIALDESIDVVKDFSIKNNMDWNHAYVDSNNRKGIITDLRIKEYPTFILLDNNLKILYRGSSEVALKNIEKML
    ISNSSSKTLNH

    >gi|295136251|ref|YP_003586927.1| thioredoxin [Zunongwangia profunda SM-A87]
    MAIEITDANFEETVLKSDKPVMVDFWAAWCGPCRMVGPVIEELSGEYEGKAVVGKLDVDANQEFAAKYGVRNIPTVLIFQ
    NGEVVGRQVGVAPKNTYADALNELL

    >gi|295136405|ref|YP_003587081.1| hypothetical protein ZPR_4585 [Zunongwangia profunda SM-A87]
    MSFKNHHYLIALIILLCASCKNSDKNLAESASLEEETIPTLQNKPIDTINAKAILIGKTDAPYNFKYFNLLVHTGLFNEV
    SNIQQENHGDSLYVEIQKLSKPQIIDLIAFEEGGLPPLFSRFFITPGDSIFMEIKNHKISFSGKNAAHYNFFQQLEETAT
    GNWGVFKGDFDQYKNDNTKFYNQKKKILENYIKAHPEVSKDFKQQTYAALKYEYLLHLISPRDHQLSNGTYQGSDLDEVI
    NKMQFDGEVAMFDAKEYFDTINFEDDFNRPELLYNDCFKRTLPKYIHSVFANAEVPGYSIDNFINERDFIKSNLDNDLES
    FAIARLIYNYHEAGLAFGQKGKTLIEELINDYREEFSKKEDYVSKINEIIFDLNSMDFKLSEQLLDEKLINLKGDSIKLK
    DIFKNDPSKFKLIDNWASW
    CAPCIAEMQKSDEYNPMLKEKDISTVYISVDEDLEKWEETVNQLENYTNKEQHYRFADFKK
    SNLAHVFLQLGKTKNRYSIPKYTLIKNDSIILSTNSPRPSKQEEFLSLLD

    >gi|295136422|ref|YP_003587098.1| glutathione reductase [Zunongwangia profunda SM-A87]
    MGIEEFDVFVIGTGTAGKGVAKDCAEAGWKVAIADNREYGGTCPNRGCDPKKVLVGITEIIERSQNMLGLGISKMPEVNW
    EDLQKFKYKFTGAIPAATEKDLAALGIKMYHQSPKFLDENTLSVEGKTVKTKKIVIATGNKPMPLKIPGAELMLNSDDFL
    ELEKLPESMIFIGAGYIGMEFAHIAARLGVEVTVIDTEPRPLSNFDEDMVAHLTEASEAIGIKFIFNAKASKVEKLRKYL
    RVTAETKNGEEISAKAELIFNTAGRVPSIDELELEKGNVAFTNKGITVNEHLQNTSNPSVYACGDVSDSEGLPLTPLSSQ
    ESRVVSANLLGKYNKTEAHYPPQPSVVFTLPNVASVGLSEQQAKERGFDYVVKHKSVPSWFNSKRIANQHYAFKVIKDKE
    TEKVLGAHLVGPDAGEMINMFVMAMCGGLSCHDLKAMIFAYPTWSNDIKGMT

    >gi|295132477|ref|YP_003583153.1| electron transport protein [Zunongwangia profunda SM-A87]
    MKKKYSYIGLAIIILIFGIIVIPKIVDKMNNGEIVEGDRLNKEGTKRPTKESPEVGYLEFNGEKRKAPSFEFIDQHGDTI
    SNEDYLGKVYVVEFFFTT
    CPTICPVMSENLVEVQDELKDYENEFGVASFSIDPEHDTPQVLSEYADQYGITNPNWHLLTG
    EKEKIYQLANAGFQTYAGEDPDVKGGFVHSGMFALIDKEGYIRSRKDNFGNPLIYYRGFVKRNASIAEGEEEPQIDMLIE
    DIKTLL