Yersinia pseudotuberculosis YPIII uid59151

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170022375|ref|YP_001718880.1| glutathione reductase [Yersinia pseudotuberculosis YPIII]
    MTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKQLGGTCVNVGCVPKKVMWHAAQIAEAIHLYGPDYGFDTTVNHFD
    WKKLIANRTAYIDRIHQSYERGLGNNKVDVIQGFARFVDAHTVEVNGETITADHILIATGGRPSHPDIPGAEYGIDSDGF
    FELDEMPKRVAVVGAGYIAVEIAGVLNGLGTETHLFVRKHAPLRTFDPLIVETLLEVMNTEGPKLHTESVPKAVIKNADG
    SLTLQLENGTEVTVDHLIWAIGREPATDNLNLSVTGVKTNDKGYIEVDKFQNTNVKGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLTEPQAREKFGDDQVKVYTSSFTAMYSAVTQHRQPCRMKLVCVGAEE
    KIVGIHGIGFGMDEILQGFAVAMKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|170022420|ref|YP_001718925.1| thiosulfate sulfurtransferase [Yersinia pseudotuberculosis YPIII]
    MEQFEAISVEQAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTNSSLHTFMQQTDFDQPVMVMCYHGNSSKGAAQYLLQ
    QGFDVVYSIDGGFEAWARSYPQDITSESR

    >gi|170022603|ref|YP_001719108.1| UBA/THIF-type NAD/FAD binding protein [Yersinia pseudotuberculosis YPIII]
    MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGGLGSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILY
    RTADIGQTLSNPTSSVSHNKARLAQRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVAAQ
    KPLISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELSQRN
    CRTAGVLGPVVGVIGTLQALEAIKMLAGIPLALSGKLRLF
    DGKQQSWSTLQLTRAAHCPACGGGL

    >gi|170023170|ref|YP_001719675.1| thiol:disulfide interchange protein DsbC [Yersinia pseudotuberculosis YPIII]
    MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPIPGISTVMTESGVLYISADGKHLLQGPLYDVSGDQP
    INVTNQALLKKLEALSSEMIVYKAPEEKHVITVFTDIT
    CGYCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSI
    WCMADRNKAFDDAMKNNDISPATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKEMLQMLNAHQASLKAGG

    >gi|170023365|ref|YP_001719870.1| glutaredoxin-like protein NrdH [Yersinia pseudotuberculosis YPIII]
    MSIIIYSKPDCVQCNATYRAFDRQGISYQIIDLTEDEQALNHVKSLGYQQVPVIVAGDEHWSGFHPDKINALVQAVSV

    >gi|170023524|ref|YP_001720029.1| iron-sulfur cluster assembly protein [Yersinia pseudotuberculosis YPIII]
    MSISISDSAAQRVSAFLNHRGKGLGLRLGVRTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVIIDGKSMVYLDGTELDFV
    KEGLNEGFKFNNPNVSNECGCGESFNV

    >gi|170023597|ref|YP_001720102.1| arsenate reductase [Yersinia pseudotuberculosis YPIII]
    MKDVTIYHNPRCSKSRETLALVEQQGITPQVVLYLETPPSVDKLKELLQQLGFSDARQLMRTKEDLYKTLNLDDRGLTQD
    QLLQAMADNPKLIERPIVVTQGKARIGRPPEQVLEILK

    >gi|170023602|ref|YP_001720107.1| thioredoxin-dependent thiol peroxidase [Yersinia pseudotuberculosis YPIII]
    MSPLKAGDIAPKFSLPDQDGEQISLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKSAGVEVLGISTDKPEKLSR
    FAEKELLNFTLLSDEHHEVAEQFGVWGEKSFMGKTYDGIHRISFLIDADGKVEHVFDNFKTNNHHDIVMDYLRQNA

    >gi|170023615|ref|YP_001720120.1| hypothetical protein YPK_1373 [Yersinia pseudotuberculosis YPIII]
    MSDRPVTPALRLYGIKNCDTIKKARRWLEEQGIAYQFHDYRADGLSDECLQGFIDTLGWEPLLNTRGTTWRKLPPEQRDA
    ITDAQSAKTLMLAQPAIIKRPLLEGLNGEMLLGFKIESYQEFIHNQPVTEVQ

    >gi|170023663|ref|YP_001720168.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Yersinia pseudotuberculosis YPIII]
    MGKTIVIVGGVAGGASAAARLRRLNEYDNIIILERGEYISFANCGLPYYIGGVITERGKLLIQTPEKMKDRFNIDVRTEN
    EVVDIDSASKTITVINHKVGKEEFIQYDTLILSPGARPFIPDIAGLSVNSSVFTLRNMLDTDNIKAYLISATPEAVTIIG
    GGFIGLEMAENLVSSGLKVTIIELSNQILSPLDYEMAAIVEKHLKDNGVDVIKNDAVVQFDESAHQIHLKSGKIITTDMV
    ILAIGVEPENDLAKKAHLDLGIRGSILVNEKLQTSVADIYAIGDAIQVVDYINGQATYIPLAWPANRQGRLLADIINGRD
    VRYHGTLGTAIAKVLDLSAACTGNNERLLKRLAIPYQVVHIHGMSHASYYPGAHQISLKLLFSPENGRILGAQAVGQGGT
    DKRIDVLATAIKGRLTIYDLPDLELAYAPPYSSAKDPVNMLGYVAENISNGDVMTKQWHEVDAFMADGGIIIDVRDEAEF
    ISGSIKTAVNIPLSELRQKLALIPQDKKILVT
    CQVGLRGYIAARILSQYGYTVANLDGGYLTFNYANA

    >gi|170023743|ref|YP_001720248.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Yersinia pseudotuberculosis YPIII]
    MKPQSSFNKLMFIPLVLFLLLVVAFLIQLTRNANGEDPTMLESALIGKPVPAFKLESLEQPGKTFDQAVLRDGKPILLNV
    WATW
    CPTCRAEHEYLNKLAAQGIRVVGLNYKDDRSKAVQWLNSLGNPYFLSLYDGDGMLGLDLGVYGAPETFLIDGQGVI
    RYRHAGDLNDRVWQQEILPLYKKYQGGA

    >gi|170023909|ref|YP_001720414.1| hypothetical protein YPK_1668 [Yersinia pseudotuberculosis YPIII]
    MPVLHNRISNEELKARMLAETEPRTTVSFYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFK
    IALFASHPALDQVRLNVAHEDDGKSFWVLRLKVRERIVADGIDDDSFDPANIGHYLKADQVNQMIDDPDTLFVDMRNHYE
    YEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMY
    CTGGIRCEKASAYMLHNGFKNVYHVEGGIIEYARKAKEQGL
    PLKFIGKNFVFDERMGERISDDVIAHCHQCGTPCDAHTNCKNDGCHLLFIQCPVCAAKFEGCCSQICQEELKLPQEEQRS
    RRAGRENGIKIFNKSKGLLQATMHIPSPEKSADEK

    >gi|170024068|ref|YP_001720573.1| putative glutathione peroxidase [Yersinia pseudotuberculosis YPIII]
    MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEVLGFPSNEFAGQEPGSDEEIH
    AFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVKPEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLA
    RFAPDMAPEAPILINAINQALASH

    >gi|170024079|ref|YP_001720584.1| hypothetical protein YPK_1840 [Yersinia pseudotuberculosis YPIII]
    MKPRMEYAPEFDNSYARQLSGFYTRLQPTPLKGARLLYHSKPLAQELGLDAHWFTEPKTAVWAGEALLPGMEPLAQVYSG
    HQFGMWAGQLGDGRGILLGEQRLNDGRYMDWHLKGAGLTPYSRMGDGRAVLRSVIREFLASEALHHLGIPTSRALTIVTS
    DHPIYREQTERGAMLLRVAESHIRFGHFEHFYYRQQPKQVQQLADYVIARHWPQWVGHQECYRLWFTDVVERTARLMAHW
    QTVGFAHGVMNTDNMSILGITMDYGPFGFLDDYVPGYICNHSDHQGRYAYDNQPAVALWNLHRLGHALSGLMSADQLQLA
    LEAYEPALMVAYGEQMRAKLGFLERDSQDNDLLTGLLSLMIKEGRDYTRTFRLLSEVEVHSAQSPLRDDFIDRAAFDDWY
    RRYRSRLQQESIDDDQRQQSMKAANPKYILRNYLAQQAITQAEKDDIQPLQRLHQALQQPFTDQPEFDDLAALPPDWGKH
    LEIS
    CSS

    >gi|170024086|ref|YP_001720591.1| iron-sulfur cluster assembly scaffold protein [Yersinia pseudotuberculosis YPIII]
    MQQKSVGTFSLDDNDWQGVTITDSAAAQITRLMQQDPQIKGLQLGVKQSGCAGFAYVMDMAKEPASDDLVFEQGSARLYV
    PLKAMPFIDGTEVDYVREGLNQIFKFNNPKAQHSCGCGESFGV

    >gi|170024105|ref|YP_001720610.1| hypothetical protein YPK_1866 [Yersinia pseudotuberculosis YPIII]
    MTTIDKIQRQITENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELV
    GGCDILMEMYQRGELQTLLKETADKYRSQEDQPAAE

    >gi|170024126|ref|YP_001720631.1| hypothetical protein YPK_1887 [Yersinia pseudotuberculosis YPIII]
    MVQFRRRNNAHWYHETQCSGSLEHCSGSPVNISTTVNVPTTVNDENPPVDIRPRAPSESDNMSTGSNITEQSIITEQGIF
    LLGVTENIAPTLQDTLYHEQPILTASDAMYQALFPTIIEINHTNTFSLYDRLSTALTVAQVTGIQRLCSHYALRLAPLPS
    PDASRESNIRLTQITQYARQLASQPTLIDRHALAQLHDVGLTDSDIIILSQIIGYVGYQARVVAGISALAGYPTVMLPGF
    PRMEDAAPNPLPDVMPNWQGWLPSHAANDDQSDKEPDETASTLTELLGHHQQSLLAYHAITTHQPNSPQLQRDWLELVAL
    VSARINGSLY
    CQARHRQHLQQLTEQPLLVTELLKGIDHALFLLPEQQIPHQLISVTAELTRAPERFNHQHVKRLQTLGVS
    DTQVIRIIFSIAITGWTNRLRYTLGK

    >gi|170024142|ref|YP_001720647.1| thiol peroxidase [Yersinia pseudotuberculosis YPIII]
    MTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVV
    LCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYD
    AALAALK

    >gi|170024182|ref|YP_001720687.1| methylated-DNA--protein-cysteine methyltransferase [Yersinia pseudotuberculosis YPIII]
    MKTFFIDRMATPQGELLLIADEENQLRAIDWTDHHDRLMKLLRNHYGADTFTLVEKRNPGGLSESMQRYFAGELSIIDTL
    PVKTAGTDFQRQVWQELRKIPCGETISYGELAKRINRPTASRAVGMANGLNPISIVVP
    CHRVIGSQGALTGYAGGVDRKR
    WLLVHEGYLLGC

    >gi|170024241|ref|YP_001720746.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pseudotuberculosis YPIII]
    MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLIYLRTLAFILV
    IAVVVQFTELVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAV
    ADVPAPFRGSSIALITAGLMSLAFMGFTGLVKF

    >gi|170024247|ref|YP_001720752.1| electron transport complex RsxE subunit [Yersinia pseudotuberculosis YPIII]
    MSEAKKLLAQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNTAVSALRRWVPSEIRIPIYVMIIASVV
    STVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVIGRAEAYAAKNPVGLSALDGFAMGMGATCALFVLGALREILGNGTLFDG
    ADMLLGSWATVLRIDILHLDTPFLLAMLPPGAFIGLGLLLAGKYVIDEKMKARKANTRVSVPQLQDGDAEKAL

    >gi|170024323|ref|YP_001720828.1| selenophosphate synthetase [Yersinia pseudotuberculosis YPIII]
    MASPAIRLTQYSHGAGCGCKISPKVLDKILHTEQQKFFDPRLLVGNETRDDAAVYDIGNGVGIISTTDFFMPIVDDPFDF
    GRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEIAQQVIEGGRYVCQQAGISLAGGHSIDAPEPIFGLAVTGIVSTE
    QVKKNSAAKPGCKLFLTKPLGIGILTTAEKKSKLRPEHRGLATETMCQLNKPGADFAHIPGVTAMTDVTGFGLLGHLSEI
    CQGSGVQAILHYSAIPRLPAVEDYIAEGCVPGGTGRNFDSYGHLIGNMSDLQRQLLCDPQTSGGLLLAVLPDAEADVQAI
    AAQHGMTLSPIGELTSADSRRALIEIVV

    >gi|170024329|ref|YP_001720834.1| methionine sulfoxide reductase B [Yersinia pseudotuberculosis YPIII]
    MAKELNPTENIEKLSDIQRYVTQERGTEAPFTGKLLHNKRDGVYQCLCCHQPLFISESKFDSGCGWPSFYQPIDADSIRY
    IDDYSHNMHRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CINSASLNFVDDQNGEQTAG

    >gi|170024345|ref|YP_001720850.1| disulfide bond formation protein B [Yersinia pseudotuberculosis YPIII]
    MLQFLNRCSRGRGAWLLMALTAFLLELTALYFQHIMLLQPCVMCIYERVALFGILGASLLGAIAPRSPLRYLAIAVWIYS
    AWKGVQLAWAHTMLQLNPSPFNT
    CDFFVNFPSWLPLDKWLPAVFAASGDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLV
    LISQFVKPKRRDLFGRKFLYISLLSMAPLWRHFYIRFKRSVNPNEHLIPCKIW

    >gi|170024474|ref|YP_001720979.1| redoxin domain-containing protein [Yersinia pseudotuberculosis YPIII]
    MWRNLKIIGLCSLLLLLSACKQEKVALGEVAPTLAAYDLQGEAVALEQWEGKLVYLNFWSVNCGGCLAEMATLNQLSQEY
    QDQAVVVAINTDPEQVEIAPVLAQHNINYPVIRDQLGITQERYQVIGTPTSFLIDRNGKVIEWHQGVRNEQELTALFKQK
    VSEKQ

    >gi|170024487|ref|YP_001720992.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pseudotuberculosis YPIII]
    MTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD
    FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIH
    CAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG
    LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL

    >gi|170024804|ref|YP_001721309.1| molybdopterin biosynthesis protein MoeB [Yersinia pseudotuberculosis YPIII]
    MLPELSDVEALRYNRQITLRGFDFDGQEKLKAAKVLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDTVALSNLQRQILHRD
    SRIGMTKVASAAQTLSEINPHLALNTLDKQLDDEQLLSLIAEHQLVLDCTDNLSTREQLNRLCHTLGKPLVSGAAIRMEG
    QVSVFTYQDNQPCYRCLSRLFGDTALT
    CVEAGVMAPLVGIIGNLQAMEAIKLLANYGQLVSGRLLMYDAMTAEFRSITLA
    KDPLCEVCQSDRRSPL

    >gi|170024912|ref|YP_001721417.1| thioredoxin reductase [Yersinia pseudotuberculosis YPIII]
    MSTAKHSKLIILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPEGLTGPALMERMHEHAEKFQTEI
    IFDHISSVDLQNRPFRLFGDGAEYTCDALIIATGASARYLGMASEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLANIAAEVHLIHRRDTFRSEKILIDRLMEKVKNGNIVLHTDRTLDEVLGDDMGVTGVRLKSTHSDETEELAVAGVF
    IAIGHSPNTGIFSDQLALENGYIKVQSGLQGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLANDK


    >gi|170024958|ref|YP_001721463.1| glutaredoxin 1 [Yersinia pseudotuberculosis YPIII]
    MFAVIFGRPECPYCVRAKELAEKLASERDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFIDEKHIGGCTDFEAYAK
    EHLSLYK

    >gi|170025090|ref|YP_001721595.1| rhodanese domain-containing protein [Yersinia pseudotuberculosis YPIII]
    MNSDFLVTPQWLAAHANDANIVILDARMSPPGVVPKRNIQAEFEQGHIPGAVYFDIDAIADHSTGLPHMLPSPQLFSEMA
    GQLGITEQHTVVIYDEGNLFSAPRVWWTFRTFGAKNVRILASGLSGWQQAGYKLESGPAHPTPQTFNVTFNAAAVSSVDE
    VLAVLGNNEVQILDARPSARYRAQEPEPRPGLRLGRIPGSINIPWGTMVENGHLKSPQALAEIFAAQGVDLTKPIITS
    CG
    SGVTAAVVVLGLAAVNARSVSLYDGSWAEWGASNSLPIDATPLA

    >gi|170025380|ref|YP_001721885.1| thioredoxin domain-containing protein [Yersinia pseudotuberculosis YPIII]
    MLTPTTIEITEANLHQAIEQSMSVPVLFYFWSERSQHCLQLTPTLDKLAAEYAGQFILARVDCDAQPMVASQFGLRSIPA
    VYLFKDGQPVDGFQGPQPEEVIRELLQRVLPKPEELKSAEAAQLMSEGKVPEALPLLKEAWQLAQQSNSPQTSEIALQLA
    EAQILLNRSEDAESVLATLPLQDRDTRYQGLIAQIELLKQAANTPEIQQLQQQLAEQPDNVELAVQLALQLHQVGRNEEA
    LELLLGHLKKDLAAANGTARKTLMDILAALGTGDALAAKYRRQLYALLY

    >gi|170025384|ref|YP_001721889.1| copper exporting ATPase [Yersinia pseudotuberculosis YPIII]
    MLQTTLLALQGLSCMNCAQRVKAALESREDVHHAEVNVHYAKVTGEADTHALIETIKQTGYQATEAQTPDVELHLSGLSC
    GHCTETVRKALEAVSGVISADVTLESANVYGKADIQTLIAAVEQAGYHATQQGIDSPKTEPLTHSAQSQPESLAAAPNTV
    PATNVALATSTVSDTNTVLPTNTALPTNTTSTTSTADTASATSTAPVINPLPVTESVAQPAASEGESVQLLLTGMS
    CASC
    VSKVQNALQRVDGVQVARVNLAERSALVTGTQNNEALIAAVKNAGYGAEIIEDEGERRERQQQMSQASMKRFQWQAALGL
    LLGIPLMAWGLFGGSMTLTPETQTPWLIIGIITLLVMIFAGGHFYRNAWVSLKNGSATMDTLVALGTGAAWIYSITVNIW
    PDVFPMEARHLYYEASAMIIGLINLGHAMEQRARQRSSNALERLLDLAPPTAKLVTDDGEKVIPLADVQLGMILRLTTGD
    RVPVDGEIVQGEVWMDEAMLTGEPIPQQKSVGDIVHAGTQVQDGTVQFRASAIGSQTTLARIIKLVRQAQSSKPEIGKLA
    DRISAVFVPTVVVIAIVAGLIWYFFGPQPQLVYTLVVATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQQ
    ASNLDTLVFDKTGTLTEGHPQVVAIHTFNGVSEQQALGWAAALETGSNHPLARAILQRAEGLTLATASQFRTLRGLGVSG
    EVDGIPLLLGNNRLLEEQQIDTRELQSLIQQQAESGATPVILTANGKPAALLSIRDPLREDSIGALQRLHQLGYSLVMLT
    GDNPITANAIAKEAGIDRVIAGVLPDGKADAIKQLQAAGHKVAMIGDGINDAPALAQADVGIAMGGGSDIAIETAAITLM
    RHSLHGVVDAVELSKATLRNMKQNLLGAFFYNALGIPIAAGILYPFTGTLLSPVVAGAAMALSSITVVSNANRLLRFKPK
    Q

    >gi|170025422|ref|YP_001721927.1| DsrE family protein [Yersinia pseudotuberculosis YPIII]
    MHSLVIIANGAAYGHESLFNALRLSIALKEQQTDLDLRLFLMSDAVIAGLNGQQPREGYNLQQMLEILTAQNVPIKLCKT
    CADARGIAGLTLVGGVEIGTLVELAQWTLAAEKVLTF

    >gi|170025484|ref|YP_001721989.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Yersinia pseudotuberculosis YPIII]
    MVLVTRQAPDFTAAAVLGNGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGIVRSQIVNDLPIGRNIDEMIRTVDA
    LQFHEEHGEVCPAQWEKGKAGMGASPDGVAKYLSENASKL

    >gi|170025518|ref|YP_001722023.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pseudotuberculosis YPIII]
    MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNF
    ITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALAGI
    REKMKYANVPAGLQGLGITFISTGLMALGFMSFAGVNL

    >gi|170025519|ref|YP_001722024.1| Na(+)-translocating NADH-quinone reductase subunit D [Yersinia pseudotuberculosis YPIII]
    MADSKEIKRVLLSPLFDNNPIALQILGVCSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHIPNSVRIIVQMVIIA
    SLVIVVDQVLRAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVGFVRELVGSGKL
    FGVTVLETVQNGGWYLPNGLFLLAPSAFFIIGLLIWGLRTLKPAQIEKE

    >gi|170025558|ref|YP_001722063.1| thioredoxin 2 [Yersinia pseudotuberculosis YPIII]
    MNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAE
    RAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS

    >gi|170025672|ref|YP_001722177.1| iron-sulfur cluster insertion protein ErpA [Yersinia pseudotuberculosis YPIII]
    MSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFDDQVNDGDMTIEKQGVELVVDPMSLQYLV
    GGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|170025704|ref|YP_001722209.1| dihydrolipoamide dehydrogenase [Yersinia pseudotuberculosis YPIII]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETILVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKVRVWKDKVINQLTGGLAGMAKGRKVKVVTGFGKFTGANTLVVDGENGPTTINFDNAIIAAGSRPIQLPFIPHEDS
    RIWDSTDALALRTVPERLLVMGGGIIGLEMGTVYHALGSKIDVVEMLDQVIPAADKDVVKVFTKRISKQFNLMLETKVTA
    VEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIHVDKQLRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKLI
    FDKETHRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKK

    >gi|170025986|ref|YP_001722491.1| methionine sulfoxide reductase A [Yersinia pseudotuberculosis YPIII]
    MQNVDNTAVIDAANALPGRLTSIPVSPLHAVHGHSMTYIPEGMDLAFFAMGCFWGAERLFWQQPGVYSTAAGYSGGHTPN
    PTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQA
    MEKAGDQRVITSEITVALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV

    >gi|170026042|ref|YP_001722547.1| thiol:disulfide interchange protein precursor [Yersinia pseudotuberculosis YPIII]
    MAQRFITLILLLCSVLLAPHSAQSSLFGENTSFGAKNSQSRFIPVDQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIV
    PQQAALGAFTLPEGITHHDEFYGEVEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTAS
    GTAAVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVILGREKPHSQRRILILAVVY
    VQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVLLALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAM
    GALAGLICSPCTTAPLSAILLYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILALP
    VFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPLQDWAFNGNTQQNAVKHINFQPV
    ANLPQLQAVLAQAQGKPVMLDLYADW
    CVACKEFEKYTFSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTIL
    FFDSQGNEITAARVTGFMDAAQFLQHLQNTPAVTK

    >gi|170026111|ref|YP_001722616.1| putative inner membrane protein [Yersinia pseudotuberculosis YPIII]
    MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEFTRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRID
    GMMIIGMFAGCIAAALWANNIKLRKPQHTIRIAQALVGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGAKFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLGIAMLCGIGFGLLIERAQI
    CFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVEPKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    IHYWWVGLGNIIGATLLAYYWDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSALI
    KESL

    >gi|170026196|ref|YP_001722701.1| zinc/cadmium/mercury/lead-transporting ATPase [Yersinia pseudotuberculosis YPIII]
    MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISHDSVSEHSHHDGESCSHTHADEADEESDRLDTTIVSG
    TQRFSWQVKGMD
    CPSCARKIENAISGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATE
    SRLREYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTPFAIETLMSVAAIGAVFIGATAE
    AAMVLLLFMVGELLESYAVNRARRGVTALMALVPEEALLLKDGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASF
    DESALTGESIPVERQQGEKVAAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPIIILFS
    ILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGRSQIIAFDKTGTLT
    EGKPKVTDVLPISGISETRLLTLAAAVEAGSHHPLAIAIIQCAQKNQRAQQNTPMLPLAEERRALAGVGIEGVVDGLMVR
    VSAPSKLSPALLTDEWQAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAIDALKKLGIQGVMLTGDNPRAAAA
    IAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGDGINDAPAMKASSIGVAMGSGTDVALETADAALTHNRLTGLAEII
    LLSRAANANIRQNITIALGLKAIFLVTTLLGLTGLWLAVLADSGATALVTANALRLLRKRDV

    >gi|170026245|ref|YP_001722750.1| thioredoxin [Yersinia pseudotuberculosis YPIII]
    MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLL
    LFRDGEVVATKVGALSKGQLKAFLDANL

    >gi|170026285|ref|YP_001722790.1| soluble pyridine nucleotide transhydrogenase [Yersinia pseudotuberculosis YPIII]
    MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIK
    SSFADILNHADRVINQQTRMRQGFYDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNH
    ERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNEEF
    EQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLAS
    AAYDQGRIAAQAMIKGEANVHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKILF
    HRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|170026287|ref|YP_001722792.1| glutaredoxin family protein [Yersinia pseudotuberculosis YPIII]
    MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGAFTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVND
    TFVMNAWKSDQHAENITFVPDGNGEFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    KYLAPDFKVQESVAVFTKPG
    CPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVPQIFIGGRHIGGSDDLEKY
    LPA

    >gi|170026288|ref|YP_001722793.1| dihydrolipoamide dehydrogenase [Yersinia pseudotuberculosis YPIII]
    MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLI
    NGREVMDRVKRERDRFVGFVLEGVETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNEL
    GDRLIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRDYAAKTLGDEFYLDPDVKV
    ELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDKLGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQ
    LPLLHEASDQARIAGVNAGGFPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVMLK
    NKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEEGLRTALRDLQSKLKLGADEAER
    CLRCPGE

    >gi|170026341|ref|YP_001722846.1| AraC family transcriptional regulator [Yersinia pseudotuberculosis YPIII]
    MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKAEHIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQV
    EKISQACRLIELAETPPKLNELAAQLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSS
    RFYAQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQLQDKFPQANLVGGDAEFE
    QWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPIGETASYADIASRIGSPTAVRAVAGACAANILAVAIP
    CHR
    VIRQDGALSGYRWGVERKRLLLERESVEKEAEDH

    >gi|170026346|ref|YP_001722851.1| glutaredoxin 3 [Yersinia pseudotuberculosis YPIII]
    MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMIARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDP
    LL

    >gi|170026347|ref|YP_001722852.1| rhodanese domain-containing protein [Yersinia pseudotuberculosis YPIII]
    MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGEATRLINKEDAVVVDIRTREDYRKGHIANSINLIPS
    DIKNGNLGELEKHKTQPIIVV
    CAMGTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK

    >gi|170026403|ref|YP_001722908.1| periplasmic protein disulfide isomerase I [Yersinia pseudotuberculosis YPIII]
    MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFFSFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHV
    EFLGPLGKQLTQAWAVAMALGVEEKITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAA
    EDLQLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK