Yersinia pestis Z176003 uid47317

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294502125|ref|YP_003566187.1| secreted thiol:disulfide interchange protein DsbA [Yersinia pestis Z176003]
    MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFFSFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHV
    EFLGPLGKQLTQAWAVAMALGVEEKITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAA
    EDLQLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK

    >gi|294502170|ref|YP_003566232.1| hypothetical protein YPZ3_0060 [Yersinia pestis Z176003]
    MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGEATRLINKEDAVVVDIRTREDYRKGHIANSINLIPS
    DIKNGNLGELEKHKTQPIIVV
    CAMGTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK

    >gi|294502175|ref|YP_003566237.1| bifunctional regulatory protein/DNA repair protein [Yersinia pestis Z176003]
    MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKAENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQV
    EKISQACRLIELAETPPKLNELAAQLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSS
    RFYAQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQLQDKFPQANLVGGDAEFE
    QWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPIGETASYADIASRIGSPTAVRAVAGACAANILAVAIP
    CHR
    VIRQDGALSGYRWGVERKRLLLEREGVEKEAEDH

    >gi|294502215|ref|YP_003566277.1| hypothetical protein YPZ3_0105 [Yersinia pestis Z176003]
    MEQFEATSVEQAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTNSSLHTFMQQTDFDQPVMVMCYHGNSSKGAAQYLLQ
    QGFDVVYSIDGGFEAWARSYPQDITSESR

    >gi|294502346|ref|YP_003566408.1| putative integral membrane protein [Yersinia pestis Z176003]
    MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEFTRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRID
    GMMIIGMFAGCIAAALWANNIKLRKPQHTIRIAQALVGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGAKFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLGIAMLCGIGFGLLIERAQI
    CFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVEPKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    IHYWWVGLGNIIGATLLAYYWDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSALI
    KESL

    >gi|294502457|ref|YP_003566519.1| thiol:disulfide interchange protein precursor [Yersinia pestis Z176003]
    MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPVDQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIV
    PQQAALGAFTLPEGITHHDEFYGEVEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTAS
    GTAAVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVILGREKPHSQRRILILAVVY
    VQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVLLALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAM
    GALAGLICSPCTTAPLSAILLYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILALP
    VFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPLQDWAFNGNTQQNAVKHINFQPV
    ANLPQLQAVLAQAQGKPVMLDLYADW
    CVACKEFEKYTFSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTIL
    FFDSQGNEITAARVTGFMDAAQFLQHLQNTPAVTK

    >gi|294502942|ref|YP_003567004.1| thiol:disulfide interchange protein (DsbC) [Yersinia pestis Z176003]
    MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPIPGISTVMTESGVLYISADGKHLLQGPLYDVSGDQP
    INVTNQALLKKLEALSSEMIVYKAPEEKHVITVFTDIT
    CGYCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSI
    WCMADRNKAFDDAMKNNDISPATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKEMLQMLNAHQASLKAGG

    >gi|294503211|ref|YP_003567273.1| putative sulfurtransferase [Yersinia pestis Z176003]
    MNSDFLVTPQWLAAHANDANIVILDARMSPPGVVPKRNIQAEFEQGHIPGAVYFDIDAIADHSTGLPHMLPSPQLFSEMA
    GQLGITEQHTVVIYDEGNLFSAPRVWWTFRTFGAKNVRILASGLSGWQQAGYKLESGPAHPTPQTFNVTFNAAAVSSVDE
    VLAVLGNNEVQILDARPSARYRAQEPEPRPGLRLGRIPGSINIPWGTMVENGHLKSPQALAEIFAAQGVDLTKPIITS
    CG
    SGVTAAVVVLGLAAVNARSVSLYDGSWAEWGASNSLPIDATPLA

    >gi|294503364|ref|YP_003567426.1| thioredoxin reductase [Yersinia pestis Z176003]
    MSTAKHSKLIILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPEGLTGPALMERMHEHAEKFQTEI
    IFDHISSVDLQNRPFRLFGDGAEYTCDALIIATGASARYLGMASEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLANIAAEVHLIHRRDTFRSEKILIDRLMEKVKNGNIVLHTDRTLDEVLGDDMGVTGVRLKSTHSDETEELAVAGVF
    IAIGHSPNTGIFSDQLALENGYIKVQSGLQGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLANDK


    >gi|294503472|ref|YP_003567534.1| molybdopterin biosynthesis protein [Yersinia pestis Z176003]
    MLPELSDVEALRYNRQITLRGFDFDGQEKLKAAKVLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDTVALSNLQRQILHRD
    SRIGMTKVASAAQTLSEINPHLALNTLDKQLDDEQLLSLIAEHQLVLDCTDNLSTREQLNRLCHTLGKPLVSGAAIRMEG
    QVSVFTYQDNQPCYRCLSRLFGDTALT
    CVEAGVMAPLVGIIGNLQAMEAIKLLANYGQLVSGRLLMYDAMTAEFRSITLA
    KDPLCEVCQSDRRSPL

    >gi|294503573|ref|YP_003567635.1| putative vitamin B12 transport protein [Yersinia pestis Z176003]
    MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEVLGFPSNEFAGQEPGSDEEIH
    AFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVKPEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLA
    RFAPDMAPEAPILINAINQALASH

    >gi|294503585|ref|YP_003567647.1| hypothetical protein YPZ3_1475 [Yersinia pestis Z176003]
    MNTDNMSILGITMDYGPFGFLDDYVPGYICNHSDHQGRYAYDNQPAVALWNLHRLGHALSGLMSADQLQLALEAYEPALM
    VAYGEQMRAKLGFLERDSQDNDLLTGLLSLMIKEGRDYTRTFRLLSEVEVHSAQSPLRDDFIDRAAFDDWYRRYRSRLQQ
    ESIDDDQRQQSMKAANPKYILRNYLAQQAITQAEKDDIQPLQRLHQALQQPFTDQPEFDDLAALPPDWGKHLEIS
    CSS

    >gi|294503592|ref|YP_003567654.1| iron-sulfur cluster assembly scaffold protein [Yersinia pestis Z176003]
    MQQESVGTFSLDDNDWQGVTITDSAAAQITRLMQQDPQIKGLQLGVKQSGCAGFAYVMDMAKEPASDDLVFEQGSARLYV
    PLKAMPFIDGTEVDYVREGLNQIFKFNNPKAQHSCGCGESFGV

    >gi|294503611|ref|YP_003567673.1| hypothetical protein YPZ3_1501 [Yersinia pestis Z176003]
    MTTIDKIQRQITENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELV
    GGCDILMEMYQRGELQTLLKETADKYRSQEDQPAAE

    >gi|294503629|ref|YP_003567691.1| hypothetical protein YPZ3_1519 [Yersinia pestis Z176003]
    MVQFRRRNNAHWYHETQCSGSLEHCSGSPVNISTTVNVPTTVNNENPPVDIRPRDPSESDNMSTGSNITEQSIITEQGIF
    LLGVTENIAPTLQDTLYHEQPILTASDAMYQALFPTIIEINHTNTFSLYDRLSTALTVAQVTGIQRLCSHYALRLAPLPS
    PDASRESNIRLTQITQYARQLASQPTLIDRHALAQLHDVGLTDSDIIILSQIIGYVGYQARVVAGISALAGYPTVMLPGF
    PRMEDAAPSPLPDVMPNWQGWLPSHAANDDQPDKEPDETASTLTELLGHHQQSLLAYHAITTHQPNSPQLQRDWLELVAL
    VSARINGSLY
    CQARHRQHLQQLTEPPLLVTELLKGIDHALFLLPEQQIPHQLISVTAELTRAPERFNHQHVKRLQTLGVS
    DTQVMRIIFSIAITGWTNRLRHTLGK

    >gi|294503645|ref|YP_003567707.1| thiol peroxidase [Yersinia pestis Z176003]
    MTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVV
    LCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYD
    AALAALK

    >gi|294503682|ref|YP_003567744.1| putative methylated-DNA--protein-cysteine methyltransferase [Yersinia pestis Z176003]
    MKTFFIDRMATPQGELLLIADEENQLRAIDWTDHHDRLMKLLRNHYGADTFTLVEKRNPGGLSESMQRYFAGELSIIDTL
    PVKTAGTDFQRQVWQELRKIPCGETISYGELAKRINRPTASRAVGMANGLNPISIVVP
    CHRVIGSQGALTGYAGGVDRKR
    WLLVHEGYLLGC

    >gi|294503721|ref|YP_003567783.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis Z176003]
    MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLIYLRTLAFILV
    IAVVVQFTELVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAV
    ADVPAPFRGSSIALITAGLMSLAFMGFTGLVKF

    >gi|294503727|ref|YP_003567789.1| NADH-ubiquinone oxidoreductase [Yersinia pestis Z176003]
    MSEAKNLLAQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNTAVSALRRWVPSEIRIPIYVMIIASVV
    STVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVIGRAEAYAAKNPVGLSALDGFAMGMGATCALFVLGALREILGNGTLFDG
    ADMLLGSWATVLRIDILHLDTPFLLAMLPPGAFIGLGLLLAGKYVIDEKMKARKANTRVSVPQLQDGDAEKAL

    >gi|294503790|ref|YP_003567852.1| selenophosphate synthetase [Yersinia pestis Z176003]
    MASPAIRLTQYSHGAGCGCKISPKVLDKILHTEQQKFFDPRLLVGNETRDDAAVYDIGNGVGIISTTDFFMPIVDDPFDF
    GRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEIAQQVIEGGRYVCQQAGISLAGGHSIDAPEPILGLAVTGIVSTE
    QVKKNSAAKPGCKLFLTKPLGIGILTTAEKKSKLRPEHRGLATETMCQLNKPGADFAHIPGVTAMTDVTGFGLLGHLSEI
    CQGSGVQAILHYSAIPRLPAVEDYIAEGCVPGGTGRNFDSYGHLIGNMSDLQKQLLCDPQTSGGLLLAVLPDAEADVQAI
    AAQHGMTLSPIGELTSADSRRALIEIVV

    >gi|294503796|ref|YP_003567858.1| methionine sulfoxide reductase B [Yersinia pestis Z176003]
    MAKELNPTENIEKLSDIQRYVTQERGTEAPFTGKLLHNKRDGVYQCLCCHQPLFISESKFDSGCGWPSFYQPIDADSIRY
    IDDYSHNMHRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CINSASLNFVDDQNGEQTAG

    >gi|294503810|ref|YP_003567872.1| disulfide bond formation protein B [Yersinia pestis Z176003]
    MENKDMLQFLNRCSRGRGAWLLMALTAFLLELTALYFQHIMLLQPCVMCIYERVALFGILGASLLGAIAPRSPLRYLAIA
    VWIYSAWKGVQLAWAHTMLQLNPSPFNT
    CDFFVNFPSWLPLDKWLPAVFAASGDCSERQWQFMSLEMPQWLVGIFAAYLV
    IAVLVLISQFVKPKRRDLFGR

    >gi|294503920|ref|YP_003567982.1| putative rhodanese-like protein [Yersinia pestis Z176003]
    MSAIEQLSYYQKKLAYETDSWDLYLALKNSENVVVVDGRSKEVYQREHIPGAINQPHKEICFNNTEKLDKTKIYICYCDG
    IG
    CNASTKTAMKLMTLGFQVKELLGGLDWWKRDGYSTEGIEGKEGTPISCGC

    >gi|294504214|ref|YP_003568276.1| hypothetical protein YPZ3_2104 [Yersinia pestis Z176003]
    MPVLHNRISNEELKARMLAETEPRTTVSFYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFK
    IALFASHPALDQVRLNVAHEDDGKSFWVLRLKVRERIVADGIDDDSFDPANIGHYLKADQVNQMIDDPDTLFVDMRNHYE
    YEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMY
    CTGGIRCEKASAYMLHNGFKNVYHVEGGIIEYARKAKEQGL
    PLKFIGKNFVFDERMGERISDDVIAHCHQCGTPCDAHTNCKNDGCHLLFIQCPVCAAKFEGCCSQICQEELKLPQEEQRS
    RRAGRENGIKIFNKSKGLLQATMHIPSPEKSADEK

    >gi|294504298|ref|YP_003568360.1| glutathione reductase [Yersinia pestis Z176003]
    MTGYLMETTLMTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKQLGGTCVNVGCVPKKVMWHAAQIAEAIHLYGPDY
    GFDTTVNHFDWKKLIANRTAYIDRIHQSYERGLGNNKVDVIQGFARFVDAHTVEVNGETITADHILIATGGRPSHPDIPG
    AEYGIDSDGFFELDEMPKRVAVVGAGYIAVEIAGVLNGLGTETHLFVRKHAPLRTFDPLIVETLLEVMNTEGPKLHTESV
    PKAVIKNADGSLTLQLENGTEVTVDHLIWAIGREPATDNLNLSVTGVKTNDKGYIEVDKFQNTNVKGIYAVGDNTGVVEL
    TPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLTEPQAREKFGDDQVKVYTSSFTAMYSAVTQHRQPCR
    MKLVCVGAEEKIVGIHGIGFGMDEILQGFAVAMKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|294504672|ref|YP_003568734.1| thiol:disulfide interchange protein DsbE [Yersinia pestis Z176003]
    MKPQSSFNKLMFIPLVLFLLLVVAFLIQLTRNANGEDPTMLESALIGKPVPAFKLESLEQPGKTFDQAVLRDGKPILLNV
    WATW
    CPTCRAEHEYLNKLAAQGIRVVGLNYKDDRSKAVQWLNSLGNPYFLSLYDGDGMLGLDLGVYGAPETFLIDGQGVI
    RYRHAGDLNDRVWQQEILPLYKKYQGGA

    >gi|294504754|ref|YP_003568816.1| putative pyridine nucleotide-disulfide oxidoreductase [Yersinia pestis Z176003]
    MGKTIVIVGGVAGGASAAARLRRLNEYDNIIILERGEYISFANCGLPYYIGGVITERDKLLIQTPEKMKDRFNIDVRTEN
    EVVDIDSASKTITVINHKVGKEEFIQYDTLILSPGARPFIPDIAGLSVNGPVFTLRNMSDTDNIKAYLISATPEAVTVIG
    GGFIGLEMAENLVSSGLKVTIIELSNQILSPLDYEMAAIVEKHLKDNGIDVIKNDAVVQFDESAHQIHLKSGKIITTDMV
    ILAIGVEPENDLAKKAHLDLGIRGSILVNEKLQTSVADIYAIGDAIQVVDYINGQATYIPLAWPANRQGRLLADIINGRD
    VRYHGTLGTAIAKVLDLSAACTGNNERLLKRLAIPYQVVHIHGMSHASYYPGAHQISLKLLFSPENGRILGAQAVGQGGT
    DKRIDVLATAIKGRLTIYDLPDLELAYAPPYSSAKDPVNMLGYVAENISNGDVMTKQWHEVDAFMADGGIIIDVRDEAEF
    ISGSIKTAVNIPLSELRQKLALIPQDKKILVT
    CQVGLRGYIAARILSQYGYTVANLDGGYLTFNYANA

    >gi|294504799|ref|YP_003568861.1| hypothetical protein YPZ3_2689 [Yersinia pestis Z176003]
    MSDRPVTPALRLYGIKNCDTIKKARRWLEEQGIAYQFHDYRADGLSDECLQGFIDTLGWEPLLNTRGTTWRKLPPEQRDA
    ITDAQSAKALMLAQPAIIKRPLLEGPNGEMLLGFKIESYQEFIHNQPATEVQ

    >gi|294504810|ref|YP_003568872.1| bacterioferritin comigratory protein [Yersinia pestis Z176003]
    MSPLKAGDIAPKFSLPDQDGEQISLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKSAGVEVLGISTDKPEKLSR
    FAEKELLNFTLLSDEHHEVAEQFGVWGEKSFMGKTYNGIHRISFLIDADGKVEHVFDNFKTNNHHDIVMDYLRQNA

    >gi|294504814|ref|YP_003568876.1| putative arsenate reductase [Yersinia pestis Z176003]
    MKDVTIYHNPRCSKSRETLALVEQQGITPQVVLYLETPPSVDKLKELLQQLGFSDARQLMRTKEDLYKTLNLDDRGLTQD
    QLLQAMADNPKLIERPIVVTQGKARIGRPPEQVLEILK

    >gi|294504826|ref|YP_003568888.1| putative thioredoxin [Yersinia pestis Z176003]
    MLTPTTIEITEANLHQAIEQSMSVPVLFYFWSERSQHCLQLTPTLDKLAAEYAGQFILARVDCDAQPMVASQFGLRSIPA
    VYLFKDGQPVDGFQGPQPEEVIRELLQRVLPKPEELKSAEAAQLMSEGKVPEALPLLKEAWQLAQQSNSPQTSEIALQLA
    EAQILLNRSEDAESVLATLPLQDRDTRYQGLIAQIELLKQAANTPEIQQLQQQLAEQPDNVELAVQLALQLHQVGRNEEA
    LELLLGHLKKDLAAANGTARKTLMDILAALGTGDALAAKYRRQLYALLY

    >gi|294504830|ref|YP_003568892.1| cation-translocating ATPase [Yersinia pestis Z176003]
    MLQTTLLALQGLSCMNCAQRVKAALESREDVHHAEVNVHYAKVTGEADTHALIETIKQTGYQATEAQTPDVELHLSGLSC
    GHCTETVRKALEAVSGVISADVTLESANVYGKADIQTLIAAVEQAGYHATQQGIDSPKTEPLTHSAQSQPESLAAAPNTV
    PATNVALATSTVSDTNTVLPTNTALPTNTTSTTSTADTASATSTAPVINPLPVTESVAQPAASEGESVQLLLTGMS
    CASC
    VSKVQNALQRVDGVQVARVNLAERSALVTGTQNNEALIAAVKNAGYGAEIIEDEGERRERQQQMSQASMKRFQWQAALGL
    LLGIPLMAWGLFGGSMTLTPETQTPWLIIGIITLLVMIFAGGHFYRNAWVSLKNGSATMDTLVALGTGAAWIYSITVNIW
    PDVFPMEARHLYYEASAMIIGLINLGHAMEQRARQRSSNALERLLDLAPPTAKLVTDDGEKVIPLADVQLGMILRLTTGD
    RVPVDGEIVQGEVWMDEAMLTGEPIPQQKSVGDIVHAGTQVQDGTVQFRASAIGSQTTLARIIKLVRQAQSSKPEIGKLA
    DRISAVFVPTVVVIAIVAGLIWYFFGPQPQLVYTLVVATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQQ
    ASNLDTLVFDKTGTLTEGHPQVVAIHTFNGVSEQQALGWAAALETGSNHPLARAILQRAEGLTLATASQFRTLRGLGVSG
    EVDGIPLLLGNNRLLEEQQIDTRELQSLIQQQAESGATPVILTANGKPAALLSIRDPLREDSIGALQRLHQLGYSLVMLT
    GDNPITANAIAKEAGIDRVIAGVLPDGKADAIKQLQAAGHKVAMIGDGINDAPALAQADVGIAMGGGSDIAIETAAITLM
    RHSLYGVVDAVELSKATLRNMKQNLLGAFFYNALGIPIAAGILYPFTGTLLSPVVAGAAMALSSITVVSNANRLLRFKPK
    Q

    >gi|294504865|ref|YP_003568927.1| hypothetical protein YPZ3_2755 [Yersinia pestis Z176003]
    MHSLVIIANGAAYGHESLFNALRLSIALKEQQTDLDLRLFLMSDAVIAGLNGQQPREGYNLQQMLEILTAQNVPIKLCKT
    CADARGIAGLTLVDGVEIGTLVELAQWTLAAEKVLTF

    >gi|294504922|ref|YP_003568984.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis Z176003]
    MVLVTRQAPDFTAAAVLGNGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGIVRSQIVNDLPIGRNIDEMIRTVDA
    LQFHEEHGEVCPAQWEKGKAGMGASPDGVAKYLSENASKL

    >gi|294504952|ref|YP_003569014.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis Z176003]
    MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNF
    ITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALAGI
    REKMKYANVPAGLQGLGITFISTGLMALGFMSFAGVNL

    >gi|294504953|ref|YP_003569015.1| NADH-ubiquinone oxidoreductase [Yersinia pestis Z176003]
    MADSKEIKRVLLSPLFDNNPIALQILGVCSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHIPNSVRIIVQMVIIA
    SLVIVVDQVLRAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVGFVRELVGSGKL
    FGVTVLETVQNGGWYLPNGLFLLAPSAFFIIGLLIWGLRTLKPAQIEKE

    >gi|294504984|ref|YP_003569046.1| thioredoxin 2 [Yersinia pestis Z176003]
    MNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAE
    RAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS

    >gi|294505093|ref|YP_003569155.1| hypothetical protein YPZ3_2984 [Yersinia pestis Z176003]
    MSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFDDQVNDGDMTIEKQGVELVVDPMSLQYLV
    GGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|294505123|ref|YP_003569185.1| dihydrolipoamide dehydrogenase [Yersinia pestis Z176003]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETILVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKVRVWKDKVINQLTGGLAGMAKGRKVKVVTGFGKFTGANTLVVDGENGPTTINFDNAIIAAGSRPIQLPFIPHED
    SRIWDSTDALALRTVPERLLVMGGGIIGLEMGTVYHALGSKIDVVEMLDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIHVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKL
    IFDKETHRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKK

    >gi|294505347|ref|YP_003569409.1| methionine sulfoxide reductase A [Yersinia pestis Z176003]
    MQNVDNTAVIDAANALPGRLTSIPVSPLHAVHGHSMTYIPEGMDLAFFAMGCFWGAERLFWQQPGVYSTAAGYSGGHTPN
    PTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQA
    MEKAGDQRVITSEITVALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV

    >gi|294505410|ref|YP_003569472.1| thiamine biosynthesis protein ThiF [Yersinia pestis Z176003]
    MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGGLGSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILY
    RTADIGQTLSNPTSSVSHNKARLAQRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVTAQ
    KPLISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELPQRN
    CRTAGVLGPVVGVIGTLQALEAIKMLAGIPLALSGKLRLF
    DGKQQSWSTLQLTRAAHCPACGGGL

    >gi|294505484|ref|YP_003569546.1| putative P-type cation-translocating membrane ATPase [Yersinia pestis Z176003]
    MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISHDSVSEHSHHDGESCSHTHADEADEESDRLDTTIVSG
    TQRFSWQVKGMD
    CPSCARKIENAISGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATE
    SRLREYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTPFAIETLMSVAAIGAVFIGATAE
    AAMVLLLFMVGELLESYAVNRARRGVTALMALVPEEALLLKDGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASF
    DESALTGESIPVERQQGEKVAAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPIIILFS
    ILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGRSQIIAFDKTGTLT
    EGKPKVTDVLPISGISETRLLTLAAAVEAGSHHPLAIAIIQCTQQNQRAQQNQRAQQNTPMLPLAEERRALAGVGIEGVV
    DGLMVRVSAPSKLSPALLTDEWQAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAIDALKKLGIQGVMLTGDN
    PRAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGDGINDAPAMKASSIGVAMGSGTDVALETADTALTHNRLT
    GLAEIILLSRAANANIRQNITIALGLKAIFLVTTLLGLTGLWLAVLADSGATALVTANALRLLRKRDV

    >gi|294505531|ref|YP_003569593.1| thioredoxin 1 [Yersinia pestis Z176003]
    MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLL
    LFRDGEVVATKVGALSKGQLKAFLDANL

    >gi|294505564|ref|YP_003569626.1| soluble pyridine nucleotide transhydrogenase [Yersinia pestis Z176003]
    MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIK
    SSFADILNHADRVINQQTRMRQGFYDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNH
    ERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNEEF
    EQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLAS
    AAYDQGRIAAQAMIKGEANVHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKILF
    HRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|294505566|ref|YP_003569628.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis Z176003]
    MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGAFTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVND
    TFVMNAWKSDQHAENITFVPDGNGEFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    KYLAPDFKVQESVAVFTKPG
    CPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVPQIFIGGRHIGGSDDLEKY
    LPA

    >gi|294505567|ref|YP_003569629.1| dihydrolipoamide dehydrogenase [Yersinia pestis Z176003]
    MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLI
    NGREVMDRVKRERDRFVGFVLESVETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNEL
    GDRLIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRDYAAKTLGDEFYLDPDVKV
    ELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDKLGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQ
    LPLLHEASDQARIAGVNAGGFPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVMLK
    NKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEEGLRTALRDLQSKLKLGADEAER
    CLRCPGE