Yersinia pestis Pestoides F uid58619

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145597292|ref|YP_001154762.1| hypothetical protein YPDSF_4128 [Yersinia pestis Pestoides F]
    MNKTLSVMLAAGLLVSGVAGAAEKPAVAFTPEQEARIGEIAKDYLLAHPEVLVEVSQKLQAQQQEKQQQAMTAAVVQNQA
    ALLNDKGTPSYGPADAKVTVVEFFDYQ
    CIYCARLAPELEKVIKANPDVRFVFKEFPIFGQRWPASLSAAKTGLQIWKQKG
    VDAYLNYHNAIYATAHNEGKLTDADISAAAKAVKFDAKTAPDVQGTLDGINTLAQQLGFSGTPALVVLPSAGASADNVTV
    IPGYTSAEALQQAISHAAGDTKK

    >gi|145597373|ref|YP_001161448.1| thiosulfate sulfurtransferase [Yersinia pestis Pestoides F]
    MEQFEAISVEQAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTNSSLHTFMQQTDFDQPVMVMCYHGNSSKGAAQYLLQ
    QGFDVVYSIDGGFEAWARSYPQDITSESR

    >gi|145597931|ref|YP_001162007.1| thiol:disulfide interchange protein DsbC [Yersinia pestis Pestoides F]
    MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPIPGISTVMTESGVLYISADGKHLLQGPLYDVSGDQP
    INVTNQALLKKLEALSSEMIVYKAPEEKHVITVFTDIT
    CGYCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSI
    WCMADRNKAFDDAMKNNDISPATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKEMLQMLNAHQASLKAGG

    >gi|145598029|ref|YP_001162105.1| putative glutathione peroxidase [Yersinia pestis Pestoides F]
    MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEVLGFPSNEFAGQEPGSDEEIH
    AFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVKPEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLA
    RFAPDMAPEAPILINAINQALASH

    >gi|145598040|ref|YP_001162116.1| hypothetical protein YPDSF_0737 [Yersinia pestis Pestoides F]
    MKPRMEYAPEFDNSYARQLSGFYTRLQPTPLKGARLLYHSKPLAQELGLDAHWFTEPKTAVWAGEALLPGMEPLAQVYSG
    HQFGMWAGQLGDGRGILLGEQRLNDGRYMDWHLKGAGLTPYSRMGDGRAVLRSVIREFLASEALHHLGIPTSRALTIVTS
    DHPIYREQTERGAMLLRVAESHIRFGHFEHFYYRQQPKQVQQLADYVIARHWPQWVGHQECYRLWFTDVVERTARLMAHW
    QTVGFAHGVMNTDNMSILGITMDYGPFGFLDDYVPGYICNHSDHQGRYAYDNQPAVALWNLHRLGHALSGLMSADQLQLA
    LEAYEPALMVAYGEQMRAKLGFLERDSQDNDLLTGLLSLMIKEGRDYTRTFRLLSEVEVHSAQSPLRDDFIDRAAFDDWY
    RRYRSRLQQESIDDDQRQQSMKAANPKYILRNYLAQQAITQAEKDDIQPLQRLHQALQQPFTDQPEFDDLAALPPDWGKH
    LEIS
    CSS

    >gi|145598047|ref|YP_001162123.1| iron-sulfur cluster assembly scaffold protein [Yersinia pestis Pestoides F]
    MQQESVGTFSLDDNDWQGVTITDSAAAQITRLMQQDPQIKGLQLGVKQSGCAGFAYVMDMAKEPASDDLVFEQGSARLYV
    PLKAMPFIDGTEVDYVREGLNQIFKFNNPKAQHSCGCGESFGV

    >gi|145598066|ref|YP_001162142.1| hypothetical protein YPDSF_0763 [Yersinia pestis Pestoides F]
    MTTIDKIQRQITENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELV
    GGCDILMEMYQRGELQTLLKETADKYRSQEDQPAAE

    >gi|145598086|ref|YP_001162162.1| hypothetical protein YPDSF_0783 [Yersinia pestis Pestoides F]
    MVQFRRRNNAHWYHETQCSGSLEHCSGSPVNISTTVNVPTTVNNENPPVDIRPRDPSESDNMSTGSNITEQSIITEQGIF
    LLGVTENIAPTLQDTLYHEQPILTASDAMYQALFPTIIEINHTNTFSLYDRLSTALTVAQVTGIQRLCSHYALRLAPLPS
    PDASRESNIRLTQITQYARQLASQPTLIDRHALAQLHDVGLTDSDIIILSQIIGYVGYQARVVAGISALAGYPTVMLPGF
    PRMEDAAPSPLPDVMPNWQGWLPSHAANDDQPDKEPDETASTLTELLGHHQQSLLAYHAITTHQPNSPQLQRDWLELVAL
    VSARINGSLY
    CQARHRQHLQQLTEPPLLVTELLKGIDHALFLLPEQQIPHQLISVTAELTRAPERFNHQHVKRLQTLGVS
    DTQVMRIIFSIAITGWTNRLRHTLGK

    >gi|145598106|ref|YP_001162182.1| thiol peroxidase [Yersinia pestis Pestoides F]
    MTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVV
    LCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYD
    AALAALK

    >gi|145598146|ref|YP_001162222.1| methylated-DNA--protein-cysteine methyltransferase [Yersinia pestis Pestoides F]
    MKTFFIDRMATPQGELLLIADEENQLRAIDWTDHHDRLMKLLRNHYGADTFTLVEKRNPGGLSESMQRYFAGELSIIDTL
    PVKTAGTDFQRQVWQELRKIPCGETISYGELAKRINRPTASRAVGMANGLNPISIVVP
    CHRVIGSQGALTGYAGGVDRKR
    WLLVHEGYLLGC

    >gi|145598186|ref|YP_001162262.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis Pestoides F]
    MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLIYLRTLAFILV
    IAVVVQFTELVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAV
    ADVPAPFRRSSIALITAGLMSLAFMGFTGLVKF

    >gi|145598192|ref|YP_001162268.1| electron transport complex RsxE subunit [Yersinia pestis Pestoides F]
    MSEAKNLLAQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNTAVSALRRWVPSEIRIPIYVMIIASVV
    STVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVIGRAEAYAAKNPVGLSALDGFAMGMGATCALFVLGALREILGNGTLFDG
    ADMLLGSWATVLRIDILHLDTPFLLAMLPPGAFIGLGLLLAGKYVIDEKMKARKANTRVSVPQLQDGDAEKAL

    >gi|145598267|ref|YP_001162343.1| selenide, water dikinase [Yersinia pestis Pestoides F]
    MASPAIRLTQYSHGAGCGCKISPKVLDKILHTEQQKFFDPRLLVGNETRDDAAVYDIGNGVGIISTTDFFMPIVDDPFDF
    GRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEIAQQVIEGGRYVCQQAGISLAGGHSIDAPEPILGLAVTGIVSTE
    QVKKNSAAKPGCKLFLTKPLGIGILTTAEKKSKLRPEHRGLATETMCQLNKPGADFAHIPGVTAMTDVTGFGLLGHLSEI
    CQGSGVQAILHYSAIPRLPAVEDYIAEGCVPGGTGRNFDSYGHLIGNMSDLQKQLLCDPQTSGG

    >gi|145598273|ref|YP_001162349.1| methionine sulfoxide reductase B [Yersinia pestis Pestoides F]
    MAKELNPTENIEKLSDIQRYVTQERGTEAPFTGKLLHNKRDGVYQCLCCHQPLFISESKFDSGCGWPSFYQPIDADSIRY
    IDDYSHNMHRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CINSASLNFVDDQNGEQTAG

    >gi|145598287|ref|YP_001162363.1| disulfide bond formation protein B [Yersinia pestis Pestoides F]
    MENKDMLQFLNRCSRGRGAWLLMALTAFLLELTALYFQHIMLLQPCVMCIYERVALFGILGASLLGAIAPRSPLRYLAIA
    VWIYSAWKGVQLAWAHTMLQLNPSPFNT
    CDFFVNFPSWLPLDKWLPAVFAASGDCSERQWQFMSLEMPQWLVGIFAAYLV
    IAVLVLISQFVKPKRRDLFGR

    >gi|145598407|ref|YP_001162483.1| rhodanese-like protein [Yersinia pestis Pestoides F]
    MSAIEQLSYYQKKLAYETDSWDLYLALKNSENVVVVDGRSKEVYQREHIPGAINQPHKEICFNNTEKLDKTKIYICYCDG
    IG
    CNASTKTAMKLMTLGFQVKELLGGLDWWKRDGYSTEGIEGKEGTPISCGC

    >gi|145598470|ref|YP_001162546.1| thioredoxin [Yersinia pestis Pestoides F]
    MVNILMKRAAIMWRNLKIIGLCSLLLLLSACKQEKVALGEVAPTLAAYDLQGEAVALEQWEGKLVYLNFWSVNCGGCLAE
    MATLNQLSQEYQDQAVVVAINTDPEQVEIAPVLAQHNINYLVIRDQLGITQERYQVIGTPTSFLIDRNGKVIEWHQGVRN
    EQELTALFKQKVSEKQ

    >gi|145598482|ref|YP_001162558.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis Pestoides F]
    MTESYFTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALIDGVDLSFLD
    FITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIH
    CAIFGATIFMVQREYTFTESFVYGTGCGLGWMLAIISMAG
    LREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL

    >gi|145598766|ref|YP_001162842.1| molybdopterin biosynthesis protein MoeB [Yersinia pestis Pestoides F]
    MLPELSDVEALRYNRQITLRGFDFDGQEKLKAAKVLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDTVALSNLQRQILHRD
    SRIGMTKVASAAQTLSEINPHLALNTLDKQLDDEQLLSLIAEHQLVLDCTDNLSTREQLNRLCHTLGKPLVSGAAIRMEG
    QVSVFTYQDNQPCYRCLSRLFGDTALT
    CVEAGVMAPLVGIIGNLQAMEAIKLLANYGQLVSGRLLMYDAMTAEFRSITLA
    KDPLCEVCQSDRRSPL

    >gi|145599148|ref|YP_001163224.1| hypothetical protein YPDSF_1866 [Yersinia pestis Pestoides F]
    MPVLHNRISNEELKARMLAETEPRTTVSFYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFK
    IALFASHPALDQVRLNVAHEDDGKSFWVLRLKVRERIVADGIDDDSFDPANIGHYLKADQVNQMIDDPDTLFVDMRNHYE
    YEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMY
    CTGGIRCEKASAYMLHNGFKNVYHVEGGIIEYARKAKEQGL
    PLKFIGKNFVFDERMGERISDDVIAHCHQCGTPCDAHTNCKNDGCHLLFIQCPVCAAKFEGCCSQICQEELKLPQEEQRS
    RRAGRENGIKIFNKSKGLLQATMHIPSPEKSADEK

    >gi|145599298|ref|YP_001163374.1| thiol:disulfide interchange protein DsbE [Yersinia pestis Pestoides F]
    MKPQSSFNKLMFIPLVLFLLLVVAFLIQLTRNANGEDPTMLESALIGKPVPAFKLESLEQPGKTFDQAVLRDGKPILLNV
    WATW
    CPTCRAEHEYLNKLAAQGIRVVGLNYKDDRSKAVQWLNSLGNPYFLSLYDGDGMLGLDLGVYGAPETFLIDGQGVI
    RYRHAGDLNDRVWQQEILPLYKKYQGGA

    >gi|145599385|ref|YP_001163461.1| pyridine nucleotide-disulphide oxidoreductase [Yersinia pestis Pestoides F]
    MGKTIVIVGGVAGGASAAARLRRLNEYDNIIILERGEYISFANCGLPYYIGGVITERDKLLIQTPEKMKDRFNIDVRTEN
    EVVDIDSASKTITVINHKVGKEEFIQYDTLILSPGARPFIPDIAGLSVNGPVFTLRNMSDTDNIKAYLISATPEAVTVIG
    GGFIGLEMAENLVSSGLKVTIIELSNQILSPLDYEMAAIVEKHLKDNGIDVIKNDAVVQFDESAHQIHLKSGKIITTDMV
    ILAIGVEPENDLAKKAHLDLGIRGSILVNEKLQTSVADIYAIGDAIQVVDYINGQATYIPLAWPANRQGRLLADIINGRD
    VRYHGTLGTAIAKVLDLSAACTGNNERLLKRLAIPYQVVHIHGMSHASYYPGAHQISLKLLFSPENGRILGAQAVGQGGT
    DKRIDVLATAIKGRLTIYDLPDLELAYAPPYSSAKDPVNMLGYVAENISNGDVMTKQWHEVDAFMADGGIIIDVRDEAEF
    ISGSIKTAVNIPLSELRQKLALIPQDKKILVT
    CQVGLRGYIAARILSQYGYTVANLDGGYLTFNYANA

    >gi|145599431|ref|YP_001163507.1| hypothetical protein YPDSF_2157 [Yersinia pestis Pestoides F]
    MSDRPVTPALRLYGIKNCDTIKKARRWLEEQGIAYQFHDYRADGLSDECLQGFIDTLGWEPLLNTRGTTWRKLPPEQRDA
    ITDAQSAKALMLAQPAIIKRPLLEGPNGEMLLGFKIESYQEFIHNQPATEVQ

    >gi|145599443|ref|YP_001163519.1| thioredoxin-dependent thiol peroxidase [Yersinia pestis Pestoides F]
    MSPLKAGDIAPKFSLPDQDGEQISLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKSAGVEVLGISTDKPEKLSR
    FAEKELLNFTLLSDEHHEVAEQFGVWGEKSFMGKTYNGIHRISFLIDADGKVEHVFDNFKTNNHHDIVMDYLRQNA

    >gi|145599448|ref|YP_001163524.1| arsenate reductase [Yersinia pestis Pestoides F]
    MKDVTIYHNPRCSKSRETLALVEQQGITPQVVLYLETPPSVDKLKELLQQLGFSDARQLMRTKEDLYKTLNLDDRGLTQD
    QLLQAMADNPKLIERPIVVTQGKARIGRPPEQVLEILK

    >gi|145599511|ref|YP_001163587.1| iron-sulfur cluster assembly protein [Yersinia pestis Pestoides F]
    MSISISDSAAQRVSAFLNHRGKGLGLRLGVRTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVIIDGKSMVYLDGTELDFV
    KEGLNEGFKFNNPNVSNECGCGESFNV

    >gi|145599593|ref|YP_001163669.1| thioredoxin reductase [Yersinia pestis Pestoides F]
    MSTAKHSKLIILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPEGLTGPALMERMHEHAEKFQTEI
    IFDHISSVDLQNRPFRLFGDGAEYTCDALIIATGASARYLGMASEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLANIAAEVHLIHRRDTFRSEKILIDRLMEKVKNGNIVLHTDRTLDEVLGDDMGVTGVRLKSTHSDETEELAVAGVF
    IAIGHSPNTGIFSDQLALENGYIKVQSGLQGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLANDK


    >gi|145599641|ref|YP_001163717.1| glutaredoxin 1 [Yersinia pestis Pestoides F]
    MFAVIFGRPECPYCVRAKELAEKLASERDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFIDEKHIGGCTDFEAYAK
    EHLSLYK

    >gi|145599770|ref|YP_001163846.1| sulfurtransferase [Yersinia pestis Pestoides F]
    MNSDFLVTPQWLAAHANDANIVILDARMSPPGVVPKRNIQAEFEQGHIPGAVYFDIDAIADHSTGLPHMLPSPQLFSEMA
    GQLGITEQHTVVIYDEGNLFSAPRVWWTFRTFGAKNVRILASGLSGWQQAGYKLESGPAHPTPQTFNVTFNAAAVSSVDE
    VLAVLGNNEVQILDARPSARYRAQEPEPRPGLRLGRIPGSINIPWGTMVENGHLKSPQALAEIFAAQGVDLTKPIITS
    CG
    SGVTAAVVVLGLAAVNARSVSLYDGSWAEWGASNSLPIDATPLA

    >gi|145599981|ref|YP_001164057.1| putative thioredoxin [Yersinia pestis Pestoides F]
    MLTPTTIEITEANLHQAIEQSMSVPVLFYFWSERSQHCLQLTPTLDKLAAEYAGQFILARVDCDAQPMVASQFGLRSIPA
    VYLFKDGQPVDGFQGPQPEEVIRELLQRVLPKPEELKSAEAAQLMSEGKVPEALPLLKEAWQLAQQSNSPQTSEIALQLA
    EAQILLNRSEDAESVLATLPLQDRDTRYQGLIAQIELLKQAANTPEIQQLQQQLAEQPDNVELAVQLALQLHQVGRNEEA
    LELLLGHLKKDLAAANGTARKTLMDILAALGTGDALAAKYRRQLYALLY

    >gi|145599985|ref|YP_001164061.1| copper exporting ATPase [Yersinia pestis Pestoides F]
    MLQTTLLALQGLSCMNCAQRVKAALESREDVHHAEVNVHYAKVTGEADTHALIETIKQTGYQATEAQTPDVELHLSGLSC
    GHCTETVRKALEAVSGVISADVTLESANVYGKADIQTLIAAVEQAGYHATQQGIDSPKTEPLTHSAQSQPESLAAAPNTV
    PATNVALATSTVSDTNTVLPTNTALPTNTTSTTSTADTASATSTAPVINPLPVTESVAQPAASEGESVQLLLTGMS
    CASC
    VSKVQNALQRVDGVQVARVNLAERSALVTGTQNNEALIAAVKNAGYGAEIIEDEGERRERQQQMSQASMKRFQWQAALGL
    LLGIPLMAWGLFGGSMTLTPETQTPWLIIGIITLLVMIFAGGHFYRNAWVSLKNGSATMDTLVALGTGAAWIYSITVNIW
    PDVFPMEARHLYYEASAMIIGLINLGHAMEQRARQRSSNALERLLDLAPPTAKLVTDDGEKVIPLADVQLGMILRLTTGD
    RVPVDGEIVQGEVWMDEAMLTGEPIPQQKSVGDIVHAGTQVQDGTVQFRASAIGSQTTLARIIKLVRQAQSSKPEIGKLA
    DRISAVFVPTVVVIAIVAGLIWYFFGPQPQLVYTLVVATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQQ
    ASNLDTLVFDKTGTLTEGHPQVVAIHTFNGVSEQQALGWAAALETGSNHPLARAILQRAEGLTLATASQFRTLRGLGVSG
    EVDGIPLLLGNNRLLEEQQIDTRELQSLIQQQAESGATPVILTANGKPAALLSIRDPLREDSIGALQRLHQLGYSLVMLT
    GDNPITANAIAKEAGIDRVIAGVLPDGKADAIKQLQAAGHKVAMIGDGINDAPALAQADVGIAMGGGSDIAIETAAITLM
    RHSLYGVVDAVELSKATLRNMKQNLLGAFFYNALGIPIAAGILYPFTGTLLSPVVAGAAMALSSITVVSNANRLLRFKPK
    Q

    >gi|145600024|ref|YP_001164100.1| hypothetical protein YPDSF_2765 [Yersinia pestis Pestoides F]
    MHSLVIIANGAAYGHESLFNALRLSIALKEQQTDLDLRLFLMSDAVIAGLNGQQPREGYNLQQMLEILTAQNVPIKLCKT
    CADARGIAGLTLVDGVEIGTLVELAQWTLAAEKVLTF

    >gi|145600088|ref|YP_001164164.1| alkyl hydroperoxide reductase subunit c [Yersinia pestis Pestoides F]
    MVLVTRQAPDFTAAAVLGNGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGIVRSQIVNDLPIGRNIDEMIRTVDA
    LQFHEEHGEVCPAQWEKGKAGMGASPDGVAKYLSENASKL

    >gi|145600122|ref|YP_001164198.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis Pestoides F]
    MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNF
    ITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALAGI
    REKMKYANVPAGLQGLGITFISTGLMALGFMSFAGVNL

    >gi|145600123|ref|YP_001164199.1| Na(+)-translocating NADH-quinone reductase subunit D [Yersinia pestis Pestoides F]
    MADSKEIKRVLLSPLFDNNPIALQILGVCSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHIPNSVRIIVQMVIIA
    SLVIVVDQVLRAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVGFVRELVGSGKL
    FGVTVLETVQNGGWYLPNGLFLLAPSAFFIIGLLIWGLRTLKPAQIEKE

    >gi|145600165|ref|YP_001164241.1| thioredoxin 2 [Yersinia pestis Pestoides F]
    MNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAE
    RAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS

    >gi|145600197|ref|YP_001164273.1| dihydrolipoamide dehydrogenase [Yersinia pestis Pestoides F]
    MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETILVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPK
    TDIDKVRVWKDKVINQLTGGLAGMAKGRKVKVVTGFGKFTGANTLVVDGENGPTTINFDNAIIAAGSRPIQLPFIPHEDS
    RIWDSTDALALRTVPERLLVMGGGIIGLEMGTVYHALGSKIDVVEMLDQVIPAADKDVVKVFTKRISKQFNLMLETKVTA
    VEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIHVDKQLRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKLI
    FDKETHRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKK

    >gi|145600227|ref|YP_001164303.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis Pestoides F]
    MSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFDDQVNDGDMTIEKQGVELVVDPMSLQYLV
    GGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|145600594|ref|YP_001164670.1| glutathione reductase [Yersinia pestis Pestoides F]
    METTLMTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKQLGGTCVNVGCVPKKVMWHAAQIAEAIHLYGPDYGFDTT
    VNHFDWKKLIANRTAYIDRIHQSYERGLGNNKVDVIQGFARFVDAHTVEVNGETITADHILIATGGRPSHPDIPGAEYGI
    DSDGFFELDEMPKRVAVVGAGYIAVEIAGVLNGLGTETHLFVRKHAPLRTFDPLIVETLLEVMNTEGPKLHTESVPKAVI
    KNADGSLTLQLENGTEVTVDHLIWAIGREPATDNLNLSVTGVKTNDKGYIEVDKFQNTNVKGIYAVGDNTGVVELTPVAV
    AAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLTEPQAREKFGDDQVKVYTSSFTAMYSAVTQHRQPCRMKLVC
    VGAEEKIVGIHGIGFGMDEILQGFAVAMKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|145600687|ref|YP_001164763.1| zinc/cadmium/mercury/lead-transporting ATPase [Yersinia pestis Pestoides F]
    MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISHDSVSEHSHHDGESCSHTHADEADEESDRLDTTIVSG
    TQRFSWQVKGMD
    CPSCARKIENAISGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATE
    SRLREYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTPFAIETLMSVAAIGAVFIGATAE
    AAMVLLLFMVGELLESYAVNRARRGVTALMALVPEEALLLKDGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASF
    DESALTGESIPVERQQGEKVAAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPIIILFS
    ILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGRSQIIAFDKTGTLT
    EGKPKVTDVLPISGISETRLLTLAAAVEAGSHHPLAIAIIQCTQQNQRAQQNQRAQQNTPMLPLAEERRALAGVGIEGVV
    DGLMVRVSAPSKLSPALLTDEWQAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAIDALKKLGIQGVMLTGDN
    PRAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGDGINDAPAMKASSIGVAMGSGTDVALETADTALTHNRLT
    GLAEIILLSRAANANIRQNITIALGLKAIFLVTTLLGLTGLWLAVLADSGATALVTANALRLLRKRDV

    >gi|145600736|ref|YP_001164812.1| thioredoxin 1 [Yersinia pestis Pestoides F]
    MSDKIIHLSDDSFDTDVLKARGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLL
    LFRDGEVVATKVGALSKGQLKAFLDANL

    >gi|145600773|ref|YP_001164849.1| soluble pyridine nucleotide transhydrogenase [Yersinia pestis Pestoides F]
    MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIK
    SSFADILNHADRVINQQTRMRQGFYDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNH
    ERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNEEF
    EQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLAS
    AAYDQGRIAAQAMIKGEANVHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKILF
    HRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|145600775|ref|YP_001164851.1| peroxiredoxin/glutaredoxin family protein [Yersinia pestis Pestoides F]
    MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGAFTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVND
    TFVMNAWKSDQHAENITFVPDGNGEFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    KYLAPDFKVQESVAVFTKPG
    CPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVPQIFIGGRHIGGSDDLEKY
    LPA

    >gi|145600776|ref|YP_001164852.1| dihydrolipoamide dehydrogenase [Yersinia pestis Pestoides F]
    MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLI
    NGREVMDRVKRERDRFVGFVLEGVETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNEL
    GDRLIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRDYAAKTLGDEFYLDPDVKV
    ELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDKLGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQ
    LPLLHEASDQARIAGVNAGGFPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVMLK
    NKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEEGLRTALRDLQSKLKLGADEAER
    CLRCPGE

    >gi|145600821|ref|YP_001164897.1| methionine sulfoxide reductase A [Yersinia pestis Pestoides F]
    MQNVDNTAVIDAANALPGRLTSIPVSPLHAVHGHSMTYIPEGMDLAFFAMGCFWGAERLFWQQPGVYSTAAGYSGGHTPN
    PTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQA
    MEKAGDQRVITSEITVALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV

    >gi|145600875|ref|YP_001164951.1| thiol:disulfide interchange protein precursor [Yersinia pestis Pestoides F]
    MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPVDQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIV
    PQQAALGAFTLPEGITHHDEFYGEVEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTAS
    GTAAVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVILGREKPHSQRRILILAVVY
    VQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVLLALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAM
    GALAGLICSPCTTAPLSAILLYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILALP
    VFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPLQDWAFNGNTQQNAVKHINFQPV
    ANLPQLQAVLAQAQGKPVMLDLYADW
    CVACKEFEKYTFSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTIL
    FFDSQGNEITAARVTGFMDAAQFLQHLQNTPAVTK

    >gi|145600943|ref|YP_001165019.1| putative inner membrane protein [Yersinia pestis Pestoides F]
    MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEFTRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRID
    GMMIIGMFAGCIAAALWANNIKLRKPQHTIRIAQALVGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGAKFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLGIAMLCGIGFGLLIERAQI
    CFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVEPKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    IHYWWVGLGNIIGATLLAYYWDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSALI
    KESL

    >gi|145600985|ref|YP_001165061.1| thiamine biosynthesis protein ThiF [Yersinia pestis Pestoides F]
    MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGGLGSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILY
    RTADIGQTLSNPTSSVSHNKARLAQRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVTAQ
    KPLISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELPQRN
    CRTAGVLGPVVGVIGTLQALEAIKMLAGIPLALSGKLRLF
    DGKQQSWSTLQLTRAAHCPACGGGL

    >gi|145601074|ref|YP_001165150.1| bifunctional regulatory protein/DNA repair protein [Yersinia pestis Pestoides F]
    MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKAENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQV
    EKISQACRLIELAETPPKLNELAAQLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSS
    RFYAQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQLQDKFPQANLVGGDAEFE
    QWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPIGETASYADIASRIGSPTAVRAVAGACAANILAVAIP
    CHR
    VIRQDGALSGYRWGVERKRLLLEREGVEKEAEDH

    >gi|145601079|ref|YP_001165155.1| glutaredoxin 3 [Yersinia pestis Pestoides F]
    MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMIARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDP
    LL

    >gi|145601080|ref|YP_001165156.1| hypothetical protein YPDSF_3840 [Yersinia pestis Pestoides F]
    MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGEATRLINKEDAVVVDIRTREDYRKGHIANSINLIPS
    DIKNGNLGELEKHKTQPIIVV
    CAMGTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK

    >gi|145601127|ref|YP_001165203.1| periplasmic protein disulfide isomerase I [Yersinia pestis Pestoides F]
    MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFFSFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHV
    EFLGPLGKQLTQAWAVAMALGVEEKITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAA
    EDLQLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK