Yersinia pestis KIM 10 uid57875

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|22123991|ref|NP_667414.1| O6-methylguanine-DNA methyltransferase; transcription activator/repressor [Yersinia pestis KIM 10]
    MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKAENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQV
    EKISQACRLIELAETPPKLNELAAQLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSS
    RFYAQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQLQDKFPQANLVGGDAEFE
    QWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPIGETASYADIASRIGSPTAVRAVAGACAANILAVAIP
    CHR
    VIRQDGALSGYRWGVERKRLLLEREGVEKEAEDH

    >gi|22123996|ref|NP_667419.1| glutaredoxin 3 [Yersinia pestis KIM 10]
    MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMIARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDP
    LL

    >gi|22123997|ref|NP_667420.1| hypothetical protein y0076 [Yersinia pestis KIM 10]
    MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGEATRLINKEDAVVVDIRTREDYRKGHIANSINLIPS
    DIKNGNLGELEKHKTQPIIVV
    CAMGTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK

    >gi|22124235|ref|NP_667658.1| dihydrolipoamide dehydrogenase [Yersinia pestis KIM 10]
    MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLI
    NGREVMDRVKRERDRFVGFVLESVETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNEL
    GDRLIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRDYAAKTLGDEFYLDPDVKV
    ELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDKLGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQ
    LPLLHEASDQARIAGVNAGGFPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVMLK
    NKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEEGLRTALRDLQSKLKLGADEAER
    CLRCPGE

    >gi|22124236|ref|NP_667659.1| peroxiredoxin family protein [Yersinia pestis KIM 10]
    MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGAFTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVND
    TFVMNAWKSDQHAENITFVPDGNGEFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    KYLAPDFKVQESVAVFTKPG
    CPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVPQIFIGGRHIGGSDDLEKY
    LPA

    >gi|161484907|ref|NP_667661.2| soluble pyridine nucleotide transhydrogenase [Yersinia pestis KIM 10]
    MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIK
    SSFADILNHADRVINQQTRMRQGFYDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNH
    ERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNEEF
    EQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLAS
    AAYDQGRIAAQAMIKGEANVHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKILF
    HRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|22124275|ref|NP_667698.1| thioredoxin 1 [Yersinia pestis KIM 10]
    MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLL
    LFRDGEVVATKVGALSKGQLKAFLDANL

    >gi|22124325|ref|NP_667748.1| zinc/cadmium/mercury/lead-transporting ATPase [Yersinia pestis KIM 10]
    MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISHDSVSEHSHHDGESCSHTHADEADEESDRLDTTIVSG
    TQRFSWQVKGMD
    CPSCARKIENAISGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATE
    SRLREYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTPFAIETLMSVAAIGAVFIGATAE
    AAMVLLLFMVGELLESYAVNRARRGVTALMALVPEEALLLKDGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASF
    DESALTGESIPVERQQGEKVAAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPIIILFS
    ILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGRSQIIAFDKTGTLT
    EGKPKVTDVLPISGISETRLLTLAAAVEAGSHHPLAIAIIQCTQQNQRAQQNQRAQQNTPMLPLAEERRALAGVGIEGVV
    DGLMVRVSAPSKLSPALLTDEWQAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAIYALKKLGIQGVMLTGDN
    PRAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGDGINDAPAMKASSIGVAMGSGTDVALETADTALTHNRLT
    GLAEIILLSRAANANIRQNITIALGLKAIFLVTTLLGLTGLWLAVLADSGATALVTANALRLLRKRDV

    >gi|22124404|ref|NP_667827.1| thiamine biosynthesis protein ThiF [Yersinia pestis KIM 10]
    MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGGLGSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILY
    RTADIGQTLSNPTSSVSHNKARLAQRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVTAQ
    KPLISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELPQRN
    CRTAGVLGPVVGVIGTLQALEAIKMLAGIPLALSGKLRLF
    DGKQQSWSTLQLTRAAHCPACGGGL

    >gi|22124448|ref|NP_667871.1| putative inner membrane protein [Yersinia pestis KIM 10]
    MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEFTRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRID
    GMMIIGMFAGCIAAALWANNIKLRKPQHTIRIAQALVGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGAKFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLGIAMLCGIGFGLLIERAQI
    CFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVEPKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    IHYWWVGLGNIIGATLLAYYWDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSALI
    KESL

    >gi|22124516|ref|NP_667939.1| thiol:disulfide interchange protein precursor [Yersinia pestis KIM 10]
    MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPVDQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIV
    PQQAALGAFTLPEGITHHDEFYGEVEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTAS
    GTAAVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVILGREKPHSQRRILILAVVY
    VQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVLLALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAM
    GALAGLICSPCTTAPLSAILLYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILALP
    VFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPLQDWAFNGNTQQNAVKHINFQPV
    ANLPQLQAVLAQAQGKPVMLDLYADW
    CVACKEFEKYTFSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTIL
    FFDSQGNEITAARVTGFMDAAQFLQHLQNTPAVTK

    >gi|22124572|ref|NP_667995.1| methionine sulfoxide reductase A [Yersinia pestis KIM 10]
    MQNVDNTAVIDAANALPGRLTSIPVSPLHAVHGHSMTYIPEGMDLAFFAMGCFWGAERLFWQQPGVYSTAAGYSGGHTPN
    PTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQA
    MEKAGDQRVITSEITVALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV

    >gi|22124682|ref|NP_668105.1| dihydrolipoamide dehydrogenase [Yersinia pestis KIM 10]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETILVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKVRVWKDKVINQLTGGLAGMAKGRKVKVVTGFGKFTGANTLVVDGENGPTTINFDNAIIAAGSRPIQLPFIPHED
    SRIWDSTDALALRTVPERLLVMGGGIIGLEMGTVYHALGSKIDVVEMLDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIHVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKL
    IFDKETHRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKK

    >gi|22124714|ref|NP_668137.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis KIM 10]
    MGVMRMSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFDDQVNDGDMTIEKQGVELVVDPMS
    LQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|22124827|ref|NP_668250.1| thioredoxin 2 [Yersinia pestis KIM 10]
    MNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAE
    RAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS

    >gi|22124861|ref|NP_668284.1| Na(+)-translocating NADH-quinone reductase subunit D [Yersinia pestis KIM 10]
    MADSKEIKRVLLSPLFDNNPIALQILGVCSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHIPNSVRIIVQMVIIA
    SLVIVVDQVLRAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVGFVRELVGSGKL
    FGVTVLETVQNGGWYLPNGLFLLAPSAFFIIGLLIWGLRTLKPAQIEKE

    >gi|22124862|ref|NP_668285.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis KIM 10]
    MTMEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFL
    NFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALA
    GIREKMKYANVPAGLQGLGITFISTGLMALGFMSFAGVNL

    >gi|22124895|ref|NP_668318.1| peroxidase [Yersinia pestis KIM 10]
    MVLVTRQAPDFTAAAVLGNGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGIVRSQIVNDLPIGRNIDEMIRTVDA
    LQFHEEHGEVCPAQWEKGKAGMGASPDGVAKYLSENASKL

    >gi|22124959|ref|NP_668382.1| hypothetical protein y1052 [Yersinia pestis KIM 10]
    MHSLVIIANGAAYGHESLFNALRLSIALKEQQTDLDLRLFLMSDAVIAGLNGQQPREGYNLQQMLEILTAQNVPIKLCKT
    CADARGIAGLTLVDGVEIGTLVELAQWTLAAEKVLTF

    >gi|22124996|ref|NP_668419.1| copper exporting ATPase [Yersinia pestis KIM 10]
    MLQTTLLALQGLSCMNCAQRVKAALESREDVHHAEVNVHYAKVTGEADTHALIETIKQTGYQATEAQTPDVELHLSGLSC
    GHCTETVRKALEAVSGVISADVTLESANVYGKADIQTLIAAVEQAGYHATQQGIDSPKTEPLTHSAQSQPESLAAAPNTV
    PATNVALATSTVSDTNTVLPTNTALPTNTTSTTSTADTASATSTAPVINPLPVTESVAQPAASEGESVQLLLTGMS
    CASC
    VSKVQNALQRVDGVQVARVNLAERSALVTGTQNNEALIAAVKNAGYGAEIIEDEGERRERQQQMSQASMKRFQWQAALGL
    LLGIPLMAWGLFGGSMTLTPETQTPWLIIGIITLLVMIFAGGHFYRNAWVSLKNGSATMDTLVALGTGAAWIYSITVNIW
    PDVFPMEARHLYYEASAMIIGLINLGHAMEQRARQRSSNALERLLDLAPPTAKLVTDDGEKVIPLADVQLGMILRLTTGD
    RVPVDGEIVQGEVWMDEAMLTGEPIPQQKSVGDIVHAGTQVQDGTVQFRASAIGSQTTLARIIKLVRQAQSSKPEIGKLA
    DRISAVFVPTVVVIAIVAGLIWYFFGPQPQLVYTLVVATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQQ
    ASNLDTLVFDKTGTLTEGHPQVVAIHTFNGVSEQQALGWAAALETGSNHPLARAILQRAEGLTLATASQFRTLRGLGVSG
    EVDGIPLLLGNNRLLEEQQIDTRELQSLIQQQAESGATPVILTANGKPAALLSIRDPLREDSIGALQRLHQLGYSLVMLT
    GDNPITANAIAKEAGIDRVIAGVLPDGKADAIKQLQAAGHKVAMIGDGINDAPALAQADVGIAMGGGSDIAIETAAITLM
    RHSLYGVVDAVELSKATLRNMKQNLLGAFFYNALGIPIAAGILYPFTGTLLSPVVAGAAMALSSITVVSNANRLLRFKPK
    Q

    >gi|22125001|ref|NP_668424.1| putative thioredoxin [Yersinia pestis KIM 10]
    MLTPTTIEITEANLHQAIEQSMSVPVLFYFWSERSQHCLQLTPTLDKLAAEYAGQFILARVDCDAQPMVASQFGLRSIPA
    VYLFKDGQPVDGFQGPQPEEVIRELLQRVLPKPEELKSAEAAQLMSEGKVPEALPLLKEAWQLAQQSNSPQTSEIALQLA
    EAQILLNRSEDAESVLATLPLQDRDTRYQGLIAQIELLKQAANTPEIQQLQQQLAEQPDNVELAVQLALQLHQVGRNEEA
    LELLLGHLKKDLAAANGTARKTLMDILAALGTGDALAAKYRRQLYALLY

    >gi|22125126|ref|NP_668549.1| glutaredoxin-like protein [Yersinia pestis KIM 10]
    MSIIIYSKPDCVQCNATYRAFDRQGISYQIIDLTEDEQALNHVKSLGYQQVPVIVAGDEHWSGFHPDKINALVQAVSV

    >gi|22125235|ref|NP_668658.1| iron-sulfur cluster assembly protein [Yersinia pestis KIM 10]
    MSISISDSAAQRVSAFLNHRGKGLGLRLGVRTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVIIDGKSMVYLDGTELDFV
    KEGLNEGFKFNNPNVSNECGCGESFNV

    >gi|22125309|ref|NP_668732.1| oxidoreductase [Yersinia pestis KIM 10]
    MGLFAGKPFVYWQIASGLLINSRLAKRKTARKVIMKDVTIYHNPRCSKSRETLALVEQQGITPQVVLYLETPPSVDKLKE
    LLQQLGFSDARQLMRTKEDLYKTLNLDDRGLTQDQLLQAMADNPKLIERPIVVTQGKARIGRPPEQVLEILK

    >gi|22125315|ref|NP_668738.1| thioredoxin-dependent thiol peroxidase [Yersinia pestis KIM 10]
    MMSPLKAGDIAPKFSLPDQDGEQISLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKSAGVEVLGISTDKPEKLS
    RFAEKELLNFTLLSDEHHEVAEQFGVWGEKSFMGKTYNGIHRISFLIDADGKVEHVFDNFKTNNHHDIVMDYLRQNA

    >gi|22125326|ref|NP_668749.1| hypothetical protein y1428 [Yersinia pestis KIM 10]
    MSDRPVTPALRLYGIKNCDTIKKARRWLEEQGIAYQFHDYRADGLSDECLQGFIDTLGWEPLLNTRGTTWRKLPPEQRDA
    ITDAQSAKALMLAQPAIIKRPLLEGPNGEMLLGFKIESYQEFIHNQPATEVQ

    >gi|22125376|ref|NP_668799.1| NADH oxidase [Yersinia pestis KIM 10]
    MGKTIVIVGGVAGGASAAARLRRLNEYDNIIILERGEYISFANCGLPYYIGGVITERDKLLIQTPEKMKDRFNIDVRTEN
    EVVDIDSASKTITVINHKVGKEEFIQYDTLILSPGARPFIPDIAGLSVNGPVFTLRNMSDTDNIKAYLISATPEAVTVIG
    GGFIGLEMAENLVSSGLKVTIIELSNQILSPLDYEMAAIVEKHLKDNGIDVIKNDAVVQFDESAHQIHLKSGKIITTDMV
    ILAIGVEPENDLAKKAHLDLGIRGSILVNEKLQTSVADIYAIGDAIQVVDYINGQATYIPLAWPANRQGRLLADIINGRD
    VRYHGTLGTAIAKVLDLSAACTGNNERLLKRLAIPYQVVHIHGMSHASYYPGAHQISLKLLFSPENGRILGAQAVGQGGT
    DKRIDVLATAIKGRLTIYDLPDLELAYAPPYSSAKDPVNMLGYVAENISNGDVMTKQWHEVDAFMADGGIIIDVRDEAEF
    ISGSIKTAVNIPLSELRQKLALIPQDKKILVT
    CQVGLRGYIAARILSQYGYTVANLDGGYLTFNYANA

    >gi|22125468|ref|NP_668891.1| disulfide oxidoreductase [Yersinia pestis KIM 10]
    MKPQSSFNKLMFIPLVLFLLLVVAFLIQLTRNANGEDPTMLESALIGKPVPAFKLESLEQPGKTFDQAVLRDGKPILLNV
    WATW
    CPTCRAEHEYLNKLAAQGIRVVGLNYKDDRSKAVQWLNSLGNPYFLSLYDGDGMLGLDLGVYGAPETFLIDGQGVI
    RYRHAGDLNDRVWQQEILPLYKKYQGGA

    >gi|22125632|ref|NP_669055.1| hypothetical protein y1738 [Yersinia pestis KIM 10]
    MNSNQFLSVTSSKDRTYTMPVLHNRISNEELKARMLAETEPRTTVSFYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAK
    EGINAQISVPANRYDEFKIALFASHPALDQVRLNVAHEDDGKSFWVLRLKVRERIVADGIDDDSFDPANIGHYLKADQVN
    QMIDDPDTLFVDMRNHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMY
    CTGGIRCEKASAYMLHNGFKNVY
    HVEGGIIEYARKAKEQGLPLKFIGKNFVFDERMGERISDDVIAHCHQCGTPCDAHTNCKNDGCHLLFIQCPVCAAKFEGC
    CSQICQEELKLPQEEQRSRRAGRENGIKIFNKSKGLLQATMHIPSPEKSADEK

    >gi|22125808|ref|NP_669231.1| putative glutathione peroxidase [Yersinia pestis KIM 10]
    MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEVLGFPSNEFAGQEPGSDEEIH
    AFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVKPEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLA
    RFAPDMAPEAPILINAINQALASH

    >gi|22125826|ref|NP_669249.1| iron-sulfur cluster assembly scaffold protein [Yersinia pestis KIM 10]
    MIEKHKVEHMQQESVGTFSLDDNDWQGVTITDSAAAQITRLMQQDPQIKGLQLGVKQSGCAGFAYVMDMAKEPASDDLVF
    EQGSARLYVPLKAMPFIDGTEVDYVREGLNQIFKFNNPKAQHSCGCGESFGV

    >gi|22125845|ref|NP_669268.1| hypothetical protein y1953 [Yersinia pestis KIM 10]
    MRKQEMTTIDKIQRQITENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWV
    DGELVGGCDILMEMYQRGELQTLLKETADKYRSQEDQPAAE

    >gi|22125864|ref|NP_669287.1| hypothetical protein y1972 [Yersinia pestis KIM 10]
    MVQFRRRNNAHWYHETQCSGSLEHCSGSPVNISTTVNVPTTVNNENPPVDIRPRDPSESDNMSTGSNITEQSIITEQGIF
    LLGVTENIAPTLQDTLYHEQPILTASDAMYQALFPTIIEINHTNTFSLYDRLSTALTVAQVTGIQRLCSHYALRLAPLPS
    PDASRESNIRLTQITQYARQLASQPTLIDRHALAQLHDVGLTDSDIIILSQIIGYVGYQARVVAGISALAGYPTVMLPGF
    PRMEDAAPSPLPDVMPNWQGWLPSHAANDDQPDKEPDETASTLTELLGHHQQSLLAYHAITTHQPNSPQLQRDWLELVAL
    VSARINGSLY
    CQARHRQHLQQLTEPPLLVTELLKGIDHALFLLPEQQIPHQLISVTAELTRAPERFNHQHVKRLQTLGVS
    DTQVMRIIFSIAITGWTNRLRHTLGK

    >gi|161484811|ref|NP_669305.2| thiol peroxidase [Yersinia pestis KIM 10]
    MTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVV
    LCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYD
    AALAALK

    >gi|22125971|ref|NP_669394.1| electron transport complex RsxE subunit [Yersinia pestis KIM 10]
    MSEAKNLLAQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNTAVSALRRWVPSEIRIPIYVMIIASVV
    STVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVIGRAEAYAAKNPVGLSALDGFAMGMGATCALFVLGALREILGNGTLFDG
    ADMLLGSWATVLRIDILHLDTPFLLAMLPPGAFIGLGLLLAGKYVIDEKMKARKANTRVSVPQLQDGDAEKAL

    >gi|161484804|ref|NP_669400.2| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis KIM 10]
    MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLIYLRTLAFILV
    IAVVVQFTELVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAV
    ADVPAPFRGSSIALITAGLMSLAFMGFTGLVKF

    >gi|22126019|ref|NP_669442.1| O-6-alkylguanine-DNA/cysteine-protein methyltransferase [Yersinia pestis KIM 10]
    MKTFFIDRMATPQGELLLIADEENQLRAIDWTDHHDRLMKLLRNHYGADTFTLVEKRNPGGLSESMQRYFAGELSIIDTL
    PVKTAGTDFQRQVWQELRKIPCGETISYGELAKRINRPTASRAVGMANGLNPISIVVP
    CHRVIGSQGALTGYAGGVDRKR
    WLLVHEGYLLGC

    >gi|22126045|ref|NP_669468.1| selenophosphate synthetase [Yersinia pestis KIM 10]
    MASPAIRLTQYSHGAGCGCKISPKVLDKILHTEQQKFFDPRLLVGNETRDDAAVYDIGNGVGIISTTDFFMPIVDDPFDF
    GRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEIAQQVIEGGRYVCQQAGISLAGGHSIDAPEPILGLAVTGIVSTE
    QVKKNSAAKPGCKLFLTKPLGIGILTTAEKKSKLRPEHRGLATETMCQLNKPGADFAHIPGVTAMTDVTGFGLLGHLSEI
    CQGSGVQAILHYSAIPRLPAVEDYIAEGCVPGGTGRNFDSYGHLIGNMSDLQKQLLCDPQTSGGLLLAVLPDAEADVQAI
    AAQHGMTLSPIGELTSADSRRALIEIVV

    >gi|22126052|ref|NP_669475.1| methionine sulfoxide reductase B [Yersinia pestis KIM 10]
    MLLLDVVFVDFIPCQRTAKMAKELNPTENIEKLSDIQRYVTQERGTEAPFTGKLLHNKRDGVYQCLCCHQPLFISESKFD
    SGCGWPSFYQPIDADSIRYIDDYSHNMHRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CINSASLNFVDDQNGEQTAG

    >gi|161484799|ref|NP_669489.2| disulfide bond formation protein B [Yersinia pestis KIM 10]
    MLQFLNRCSRGRGAWLLMALTAFLLELTALYFQHIMLLQPCVMCIYERVALFGILGASLLGAIAPRSPLRYLAIAVWIYS
    AWKGVQLAWAHTMLQLNPSPFNT
    CDFFVNFPSWLPLDKWLPAVFAASGDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLV
    LISQFVKPKRRDLFGR

    >gi|22126185|ref|NP_669608.1| hypothetical protein y2300 [Yersinia pestis KIM 10]
    MLQRWILSTNFPVKNEVIMSAIEQLSYYQKKLAYETDSWDLYLALKNSENVVVVDGRSKEVYQREHIPGAINQPHKEICF
    NNTEKLDKTKIYICY
    CDGIGCNASTKTAMKLMTLGFQVKELLGGLDWWKRDGYSTEGIEGKEGTPISCGC

    >gi|22126247|ref|NP_669670.1| thioredoxin-family protein [Yersinia pestis KIM 10]
    MVNILMKRAAIMWRNLKIIGLCSLLLLLSACKQEKVALGEVAPTLAAYDLQGEAVALEQWEGKLVYLNFWSVNCGGCLAE
    MATLNQLSQEYQDQAVVVAINTDPEQVEIAPVLAQHNINYPVIRDQLGITQERYQVIGTPTSFLIDRNGKVIEWHQGVRN
    EQELTALFKQKVSEKQ

    >gi|22126260|ref|NP_669683.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis KIM 10]
    MDDLGVCVMTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALID
    GVDLSFLDFITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIH
    CAIFGATIFMVQREYTFTESFVYGTGCGLGWM
    LAIISMAGLREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL

    >gi|22126553|ref|NP_669976.1| molybdopterin biosynthesis protein MoeB [Yersinia pestis KIM 10]
    MPFITLSEVDMLPELSDVEALRYNRQITLRGFDFDGQEKLKAAKVLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDTVALS
    NLQRQILHRDSRIGMTKVASAAQTLSEINPHLALNTLDKQLDDEQLLSLIAEHQLVLDCTDNLSTREQLNRLCHTLGKPL
    VSGAAIRMEGQVSVFTYQDNQPCYRCLSRLFGDTALT
    CVEAGVMAPLVGIIGNLQAMEAIKLLANYGQLVSGRLLMYDAM
    TAEFRSITLAKDPLCEVCQSDRRSPL

    >gi|22126679|ref|NP_670102.1| thioredoxin reductase [Yersinia pestis KIM 10]
    MSTAKHSKLIILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPEGLTGPALMERMHEHAEKFQTEI
    IFDHISSVDLQNRPFRLFGDGAEYTCDALIIATGASARYLGMASEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLANIAAEVHLIHRRDTFRSEKILIDRLMEKVKNGNIVLHTDRTLDEVLGDDMGVTGVRLKSTHSDETEELAVAGVF
    IAIGHSPNTGIFSDQLALENGYIKVQSGLQGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLANDK


    >gi|22126732|ref|NP_670155.1| glutaredoxin 1 [Yersinia pestis KIM 10]
    MFAVIFGRPECPYCVRAKELAEKLASERDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFIDEKHIGGCTDFEAYAK
    EHLSLYK

    >gi|22126872|ref|NP_670295.1| thiosulfate sulfurtransferase [Yersinia pestis KIM 10]
    MNSDFLVTPQWLAAHANDANIVILDARMSPPGVVPKRNIQAEFEQGHIPGAVYFDIDAIADHSTGLPHMLPSPQLFSEMA
    GQLGITEQHTVVIYDEGNLFSAPRVWWTFRTFGAKNVRILASGLSGWQQAGYKLESGPAHPTPQTFNVTFNAAAVSSVDE
    VLAVLGNNEVQILDARPSARYRAQEPEPRPGLRLGRIPGSINIPWGTMVENGHLKSPQALAEIFAAQGVDLTKPIITS
    CG
    SGVTAAVVVLGLAAVNARSVSLYDGSWAEWGASNSLPIDATPLA

    >gi|22127151|ref|NP_670574.1| thiol:disulfide interchange protein DsbC [Yersinia pestis KIM 10]
    MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPIPGISTVMTESGVLYISADGKHLLQGPLYDVSGDQP
    INVTNQALLKKLEALSSEMIVYKAPEEKHVITVFTDIT
    CGYCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSI
    WCMADRNKAFDDAMKNNDISPATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKEMLQMLNAHQASLKAGG

    >gi|22127683|ref|NP_671106.1| periplasmic protein disulfide isomerase I [Yersinia pestis KIM 10]
    MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFFSFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHV
    EFLGPLGKQLTQAWAVAMALGVEEKITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAA
    EDLQLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK

    >gi|22127723|ref|NP_671146.1| glutathione reductase [Yersinia pestis KIM 10]
    MTGYLMETTLMTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKQLGGTCVNVGCVPKKVMWHAAQIAEAIHLYGPDY
    GFDTTVNHFDWKKLIANRTAYIDRIHQSYERGLGNNKVDVIQGFARFVDAHTVEVNGETITADHILIATGGRPSHPDIPG
    AEYGIDSDGFFELDEMPKRVAVVGAGYIAVEIAGVLNGLGTETHLFVRKHAPLRTFDPLIVETLLEVMNTEGPKLHTESV
    PKAVIKNADGSLTLQLENGTEVTVDHLIWAIGREPATDNLNLSVTGVKTNDKGYIEVDKFQNTNVKGIYAVGDNTGVVEL
    TPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLTEPQAREKFGDDQVKVYTSSFTAMYSAVTQHRQPCR
    MKLVCVGAEEKIVGIHGIGFGMDEILQGFAVAMKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|161484729|ref|NP_671193.2| thiosulfate sulfurtransferase [Yersinia pestis KIM 10]
    MEQFEAISVEQAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTNSSLHTFMQQTDFDQPVMVMCYHGNSSKGAAQYLLQ
    QGFDVVYSIDGGFEAWARSYPQDITSESR