Bacteroides fragilis YCH46 uid58195

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|53711315|ref|YP_097307.1| dihydrolipoamide dehydrogenase [Bacteroides fragilis YCH46]
    MKYQVIIIGGGPAGYTAAEAAGKAGLSVLLFEKQNLGGVCLNEGCIPTKTLLYSAKTYDGAKHASKYAVTVPEVFFDLPK
    IIARKSKVVRKLVLGVKSKLTSNNVTIISGEATILDKNTVRCGEETYECDNLILCTGSETFIPPIPGIDSVNYWTHREAL
    DNKELPASLAIVGGGVIGMEFASFFNSLGVKVTVIEMMDEILGGMDKELSALLRADYAKRGIQFLLSTKVVSLAQTEEGA
    VVSYENAEGAGSVIAEKLLMSVGRRPVTKGFGLENLNLQRTERGSIVVNGQMESSLPGVYVCGDLTGFSLLAHTAVREAE
    VAVHAILGKEDRMSYAAIPGVVYTNPEIAGVGQTEESLTAKGIAYRAVKLPMAYSGRFVAENEGVNGVCKVLLGEDDTIL
    GAHVLGNPASEIITLAGMAVEMKLKAAEWKKIVFPHPTVAEIFREAL

    >gi|53711338|ref|YP_097330.1| hypothetical protein BF0047 [Bacteroides fragilis YCH46]
    MKNLILVLGCFFFLISCQQTEKEKLEELVKNWNGKEVLFPTNPSFTLYGKTPVDFKIPVSDYKIVTYVDSLGCSSCKLQL
    PKWKEFMKYADSIVGYQIPVLFFLHPANVREMRSVLKQNRFDYPVCMDTEDTFNKVNKFPSQLNFQTFLLDKNNHVIAIG
    NPVHNYDVRELYIHLISGGIDGDSLSNMRTVIKIEEDMVDLGSFDWRREQHITFEIHNIGNNNLVVYDNKTS
    CGCTSVEY
    SKEPVQPGKSLAVKVTYKADHPEHFNKTIILYCNASASPLELKITGNAK

    >gi|53711754|ref|YP_097746.1| hypothetical protein BF0463 [Bacteroides fragilis YCH46]
    MGRPIKLIGYLCFLMALCSCKETKEQQISRLIHEWEGRTIVYPADMTFSVLGKDSAGYSFPQNEYTIMTYVDSVGCTGCK
    LQLPTWKRLISMVDTVAAGKVSFLFAFHPKNKKEISFLLKRDRFLYPVFIDEKGDFDALNHFPSDVNFQTFLLDSQNKVL
    AIGNPVHNKKVRDLYLQIIAGQQTGVATSSQTKVVLDKKLDEMGDFDWKIPQTATFSLRNLGDHLLIIEDINAS
    CGCTSV
    TYSKEPVPSGKSADIQVTYRAEHPEHFEKTITVYCNTPTSPIRLKIRGNAIDEEY

    >gi|53711784|ref|YP_097776.1| hypothetical protein BF0493 [Bacteroides fragilis YCH46]
    MSKMNSMLMGICFLLSSLFSCQQSKGDFKTVPVKEFASLIEDASVQRLDVRTMAEYSEGHIPGTININVLDDSFAVMADS
    TLQKDKPVALY
    CRSGKRSKKAAAILSEKGYKVYELDKGFNAWQEAGEKVEK

    >gi|53711866|ref|YP_097858.1| pyridine nucleotide-disulphide oxidoreductase [Bacteroides fragilis YCH46]
    MKIIIIGGVAGGATTAARIRRSDETAEIILLEKGKYISYANCGLPYYIGDVIEEREKLFVQTPEAFGVRFRVDVRTENEV
    IFIDRKKKTVTVRLKSEDTYEESYDKLLISTGASPVRPPLPGIDSTGIFTLRNVADTDRIKAYVNNRPPRRAVVIGAGFI
    GLEMAENLHALGAQVSIVEMGNQVMAPIDFSMAALVHQHLMEKGVNLYLEQAVASFEQAGKEVKVVFKNGQSILADIVIL
    SIGVRPETTLARAAELTIGEAGGIAVNDYLQTSDESIYAIGDAIEFRHPITGKPWLNYLAGPANRQGRIVADNLLGAQIP
    YEGAIGTSIAKVFDMTVASTGLPGKRLKQAGIVYASSTTHPASHAGYYPDAMPMSIKITFDPQTGKLYGGQIVGYDGVDK
    RIDELSLVIKHEGTIYDLMKVEQAYAPPFSSAKDPVAIAGYVAENIILGRVKPVYWRDLRDIELKDVFLLDVRTPDEFAL
    GSLPGAVNIPLDEIRDRIAELPSNKPIYTF
    CAVGLRGYLAYRILIQHGFKEVYNLSGGLKTYRAATAPIILHENEETDDT
    PSAQDSPAKPSVGAEAPQTTTAANPKTIRVDACGLQCPGPVLKMKKTMDTLVPGERVEIVATDPGFSRDAAAWCNSTGNK
    FISKDSTGGKSVVVIEKGEPQACNLTTTCDSKGKTLIMFSDDLDKALATFVLANGAAATGQKVTIFFTFWGLNVIKKLHK
    PKVEKDIFGKMFGTMLPSSSLKLKLSKMSMGGMGGKMMRYIMHRKGIDSLESLRQQALENGVEFIACQMSMDVMGVKREE
    LLDEVTVGGVATYMERADNANINLFI

    >gi|53712002|ref|YP_097994.1| thioredoxin [Bacteroides fragilis YCH46]
    MALEITDNNFKEILAEGSPVVIDFWAPWCGPCKMVGPIIDELAKEYEGKVIMGKCDVDENSDLPAEFGIRNIPTVLFFKN
    GELVDKQVGAVGKPAFVEKVEKLL

    >gi|53712081|ref|YP_098073.1| hypothetical protein BF0788 [Bacteroides fragilis YCH46]
    MKRSLLFIFTLLTITLSAVAQPRISSNKETHHFGQIEWKRPVSVEYTITNTGDKPLVLTNVTTSCACSVANWTKTPIAPG
    EKGTVSATFDAKALGHFNKSIGIYSNAQPSLVYLNFDGEVVQEIKDFTKTHPYAIGQIRIDRTDIDFPDAHSGEKPVITL
    GVVNLSDRPYEPVLMHLPPYLKMETNPTVLLKGKKGTITLTLDTKQLMDLGLTQSSVYLARFAGDKVGEENEIPVSAVLL
    PDFSGMTEQDKAVAPVIRLSESKIDLSQVLAKKNKARRDIVITNTGKSPLQISKLQVFNPAVGVALKKTVLQPGESTRLR
    VTVLKKNLGKKKRHLRILMITNDPVQPKVEIDVKATNNESHN

    >gi|53712327|ref|YP_098319.1| thioredoxin reductase [Bacteroides fragilis YCH46]
    METERIKCLIIGSGPAGYTAAIYAGRANLSPVLYEGIQPGGQLTTTTDVENFPGYPQGISGPQLMEDLRTQAERFGADIR
    FGIATASDLGQAPYKITIDGEKVIEADSLIIATGATAKYLGLDDEKKYAGMGVSA
    CATCDGFFYRKKVVAVVGGGDTACE
    EAIYLAGLASKVYLVVRKPYLRASKIMQERVRKHDKIEVLFEHNVVGLFGENGVEGMNLVKRWEEPDEERYSLPIDGFFL
    AIGHKPNSDIFKPYLDTDEVGYITTDGDSPRTKVPGVFAAGDVADPHYRQAITAAGSGCKAAIEAERYLSEKGLI

    >gi|53712506|ref|YP_098498.1| putative bacterioferritin co-migratory protein [Bacteroides fragilis YCH46]
    MNVGDKAPELLGINEKGEEVRLNNYKGRKIVLYFYPKDNTSGCTAQACSLRDNYAELRKAGYEVIGVSVDNEKSHQKFIE
    KNNLPFTLIADTDKKLVEQFGVWGEKKLYGRAYMGTLRTTFLINEEGVIERIIGPKEVKTKEHASQIL

    >gi|53712550|ref|YP_098542.1| alkyl hydroperoxide reductase subunit F [Bacteroides fragilis YCH46]
    MLDSAIKEQLRTIFAALEANYTFDITVSPQHESRTELLELLNDVASCSEKLSCRINEGKGLEFTLLKGEHRTGITFRAVP
    NGHEFSSLLLAILNTDGKGKNFPDEGICNRVKSLKGPVRLTTYVSLT
    CTNCPDVVQALNAMTTLNRQIQHQTVDGAINQA
    EVEALKIQGVPSVFADGKLIHVGRGDFGELLAKLEEQYGTETNSAETSIKKYDVIVAGGGPAGSAAAIYSARKGLNVAVI
    AERIGGQVKETVGIENLISVPSTTGSQLADNLKTHMSQYPIDLLEHRQIEKIELDGKDKVLTAKGGERFSAPAVIVATGA
    SWRKLNVPGEAEYIGRGVAF
    CPHCDGPFYKGKQVAVVGGGNSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKLKSLP
    NVEVLVHSQTTEVVGNGDKVTGIRVKDRKTEEERVISLDGIFVQIGLVANSGIFRDVVEVNRPGEIVIDAHCRTNVPGIY
    AAGDVSTVPYKQIIIAMGEGAKAALAAFEDRMRGEI

    >gi|53712551|ref|YP_098543.1| alkyl hydroperoxide reductase subunit C [Bacteroides fragilis YCH46]
    MEPIINSQMPEFKVQAFQNGSFKTVSSEDVKGKWAIFFFYPADFTFVCPTELVDVAEKYEQFQAMGVEVYSVSTDSHFVH
    KAWHDASESIRKIKYPMLADPTGVLSRGFGVMIEEDGMAYRGTFLVNPEGKIKIAEIQDNNIGRNADELLRKVEAAQFVA
    THDGEVCPAKWKKGEATLKPSIDLVGKI

    >gi|53712584|ref|YP_098576.1| putative thioredoxin [Bacteroides fragilis YCH46]
    MEEKKEARQKRNREKLATADWVMAEFYATWCPHCKRMQPVVEEFKKLMEGTLEVVQIDIDQEDALANFYTIESVPTFILM
    RKGEQLWRQSGELDLERLKKAVKDFKS

    >gi|53712739|ref|YP_098731.1| putative protein disulfide isomerase [Bacteroides fragilis YCH46]
    MKKNFFYAGGLSLLLWGMAACSGQGKADKAAVVADSVVVKTDSVAADSTGYIVKVGEPAPDFTITLTDGKQMKLSELSGK
    VVMLQFTASW
    CGVCRKEMPFIEKDIWLKHKNNPEFALIGIDRDEPLDKVIAFGKSVGVTYPLGLDPGADIFAKYALRESG
    ITRNVLIDREGKIVKLTRLYNEEEFASLVDQIDEMLKK

    >gi|53712784|ref|YP_098776.1| putative pyridine nucleotide-disulfide oxidoreductase [Bacteroides fragilis YCH46]
    MKQYDAIIIGFGKGGKTLTAELAKRGWKVALIERSAMMYGGTCPNIACVPTKRLIHEAEKVSWLYPTDYEKQAEAYKAAI
    ARKNEMTAASRANMFNKLSSLPNVTIYTGMASFVSKDVVKVTLPDEVIELQGKKIFINTGSTSIIPAIDGLKDSKRVYTS
    TSLMELDVLPRHLIIVGGGYIGLEFASMYASFGSKVTVLEGGNKFIAREDRDIADAVKETLEKKGIEIRLNARAQSIQDT
    ADGVTLTYTDTADGNPVTIEGDAILVATGRKPMTEGLNLQAAGVEVDSHGAIVVNGYLHTTAPNIWAMGDVKGGLQFTYI
    SLDDYRIIRDDLFGNKERTADDRNPVAYSVFIDPPLSHVGLTEEEAIKRGYSFKVSRLPASALPRARTLQQTDGILKAIV
    DSHSGRIMGCTLFCAESSEVINVVNMAMKTGQHYTFLRDFIFTHPSMGEGLNDLFSID

    >gi|53712908|ref|YP_098900.1| dihydrolipoamide dehydrogenase [Bacteroides fragilis YCH46]
    MRYDIAIIGGGPAGYTAAERAGANGLRAVLFEKKAMGGVCLNEGCIPTKALLYSAKVLDGIKSAPKYGVSVEGAPAFDME
    KIIGRKNKTVQKLTGGVRMTVNSYGVTIVDKEAVIEGEGEEGFHIRCDGEVYEATYLLV
    CTGSDTVIPPIKGLSDVDYWT
    SREALDSTVLPSSLAIIGGGVIGMEFASFFNSMGVRVKVIEMMPEILGAMDKETSAMLRADYTKKGVNFYLNTKVTEVSD
    KGVTVEKDGKSSFIDADRILVSVGRKANITQVGLDKLNIELHRNGVVVDEHMLTSHPRVYACGDITGFSLLAHTAIREAE
    VAINHILGIDDRMDYDCVPGVVYTNPELAGVGKTEEELIAKGIYYRIQKLPMVYSGRFVAENELGNGLCKLIIDHNDRIV
    GCHMLGNPASEIIVVAGIAIQRGYTVDEFRKSVFPHPTVGEIYHETLFA

    >gi|53712939|ref|YP_098931.1| hypothetical protein BF1649 [Bacteroides fragilis YCH46]
    MAKIKGAIVVDTERCKGCNLCVVACPLNVISLAKEVNVKGYNYAQQILEDTCNGCSSCATVCPDGCISVYKVKVE

    >gi|53713094|ref|YP_099086.1| hypothetical protein BF1805 [Bacteroides fragilis YCH46]
    MNAKKNLMAFILTVSSIALMVICLGLGMVKACAGGDGSEWKKKVVADTLHVVHYTRPDLPQIMTDPAERAVYYVKHYWDG
    YLTGDTAWVNSGDTEQLYVDFIDALKYVEPETGRKALHTMMVRMEADSTAYRRFCLLGEKYLNEPNSPMRNEDFYIAVLE
    QMLQSDRLQEWEKIRPADRLKQAHKNRPGMKAADFTYVTVHGDNSRMSRLKAQYTMLFFYDPD
    CSNCRKFEKLFAEIPAF
    VEMVENGTLRVLAIYPDENREEWAAKAVYMPQGWIVGWNKAGDIRTRQLYDIRATPTIYLLDGRKRVILKDTSMEQLIDY
    LATQAGE

    >gi|53713303|ref|YP_099295.1| Na(+)-translocating NADH-quinone reductase subunit D [Bacteroides fragilis YCH46]
    MSQLFSKKNKEVFATPLGLNNPVTVQVLGICSALAVTAKLEPAIVMGLSVTVITAFSNVVISLLRKTIPNRIRIIVQLVV
    VAALVTIVSEVLKAFAYDVSVQLSVYVGLIITN
    CILMGRLEAFAMANGPWESFLDGVGNGLGYAKILIIVAFFRELLGSG
    TLLNFRIIPESFYKMGYINNGLMLMPPMALIICACIIWYQRSRCKELQEK

    >gi|53713304|ref|YP_099296.1| Na(+)-translocating NADH-quinone reductase subunit E [Bacteroides fragilis YCH46]
    MEQLLSLFVRSIFVDNMIFAFFLGMCSYLAVSKNVKTAVGLGIAVTFVLVVTLPVNYLLQTKVLAANAIIEGVDLSFLSF
    ILFIAVIAGIVQLVEMVVERFSPSLYASLGIFLPLIAVN
    CAIMGASLFMQQRITMDPSNPQAITGVGSAVVYALGSGIGW
    LLAIVGLAAIREKMAYSDVPAPLKGLGITFITVGLMAMAFMCFSGLKL

    >gi|53713321|ref|YP_099313.1| cation-transporting ATPase [Bacteroides fragilis YCH46]
    MSNITKKAFPVLNMHCAGCANNVEKTVKKLAGVVDASVNFATNTLSVSYEADKLTPGEIRAAVLAAGYDLIVEEALKEER
    QEEAQEKHYRLLKRQVIGAWIFVVPMLLFSMVLMHVPFSNEIQLILALPVMIFFGGSFYVNAWRQARLGRSNMDTLVALS
    TSIAFLFSVFNTFFPEFWYSRGLEPHVYYEAAVVIIAFVLTGKLMEERAKGNTSTAIRKLMGLQPRVARVLREGIEEDIL
    IDQLQTGDLVVVRPGEQIPVDGRLSEGESYVDESMISGEPIPVEKKVGDRVLAGTINQKGAFVIKASGVGSETVLARIIR
    MVQEAQGSKAPVQRIVDRVTGIFVPVVLCIAVLTFVIWLLVGGTDYFSHALLSAVSVLVIACPCALGLATPTALMVGIGK
    AASNHILIKDAVALEQMRKVDVVVLDKTGTLTEGHPTVSGWLWAQVQEEHFKNVLLAAELKSEHPLAGAIVSSLQEVEKI
    VPAQLESFESITGKGIKVVYQGDTYWVGSHKLLKDFSASLSDVLAEMMVQYESDGNSIVYFGRGTEVLAVVAIADQIKPT
    SAEAVKELKRQGIDICMLTGDGQRTALAVSGKLGIDRFVADALPDDKEEFVRELQMQGKTVAMVGDGINDSQALALADVS
    IAMGKGTDIAMDVAMVTLMTSDLLLLPRAFELSKQTVKLIHQNLFWAFIYNLIGIPIAAGILFPVNGLLLNPMLASAAMA
    FSSVSVVLNSLSLARK

    >gi|53713328|ref|YP_099320.1| hypothetical protein BF2039 [Bacteroides fragilis YCH46]
    MKKILFFITMMVLSIGLAQAQGKAEIKFDKTTHDFGTFSENNPIVSCTFKFTNIGDAPLVIHQAVASCGCTVPEYTQEPI
    MPGKTGTIKVTYNGTDKYPGHFKKSITLRTNAKTEMIRLFVEGDMTAKDAK

    >gi|53713470|ref|YP_099462.1| thioredoxin [Bacteroides fragilis YCH46]
    MKVIDLTKESFVEKVAEFQEYPNKWDFKGDKPCLVDFHAPWCVYCKALSPILDQLAVEYDGKIDIYKVDVDQEPELEAAF
    AIRTIPNLLLCPMGGKPSMKLGTMNKTQLKALIEEVLL

    >gi|53713555|ref|YP_099547.1| thioredoxin peroxidase [Bacteroides fragilis YCH46]
    MRSLIGKQAPKFDATAVINGHEIVQNFSLDQYKGKKYVVFFFYPMDFTFVCPTELHAFQEKLEEFEKRDVAVVGCSVDSE
    YSHFSWLQMPKNEGGIQGVKYPIVSDFSKSISESYGVLAGSYAPDENGNWVCEGTPVAFRGLFLIDKEGVVRHCVINDLP
    LGRNVDEVLRMVDALQHFEEYGEVCPANWSKGKDAMKATEDGVANYLSKH

    >gi|53713885|ref|YP_099877.1| electron transport complex protein RnfA [Bacteroides fragilis YCH46]
    MEYILIFISAIFVNNIVLSQFLGICPFLGVSKKVDTALGMSAAVAFVLTIATIVTFLIQKFVLDAFGLQYLQTITFILVI
    AALVQMVEIILKKVSPALYQALGVFLPLITTN
    CCILGVAILVIQKDYDLLTGVVYAFSTAIGFGLALVLFAGLREQMSLV
    KIPEGMKGTPIALITAGLLAMAFMGFSGVV

    >gi|53713886|ref|YP_099878.1| electron transport complex RsxE subunit [Bacteroides fragilis YCH46]
    MNNFKVLMNGIVKENPTFVLLLGMCPTLGTTSSAINGMGMGLATMFVLICSNVVISLIKNLIPDMVRIPSFIVVIASFVT
    LLQMVMQAYVPGLYATLGLFIPLIVVN
    CIVLGRAEAFAAKNNALSSMFDGIGMGLGFTIALTLLGAVREFLGTGKVFNLS
    IIPEEYGMLVFVLAPGAFIALGYLIALINSLKKAN

    >gi|53713964|ref|YP_099956.1| thioredoxin [Bacteroides fragilis YCH46]
    MKKSILIPFLFMGLLAFASCKGTSENKSTTATDTVQAEKPQSGTIHLTRAEFLKKIADYENHSKEWKYLGDKPAIVDFYA
    DW
    CGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVLLK
    Q

    >gi|53714016|ref|YP_100008.1| thiol:disulfide interchange protein [Bacteroides fragilis YCH46]
    MKKLTYLAVAAVALGVASCNTNKPGYVITGTVEGAADGDTVFIQERVNRQFNKLDTAIIANGTFTFEGAQDSVVNRYITY
    SKDGDGVYVDFFLENGKIKVNLSKDDKSATGTPNNDAYQEIRNKINAIDQKQAAIYQAMGDSTLTDDQKMAKQKEFSELE
    EAYSQAIKEGVQKNITNPVGIMLFKQSFYENSTEDNDALLKQIPANYQNDETIVKIKDITEKQKATAAGQKFIDFEMLTP
    DGKPVKLSDYVGKGKVVLVDFWASW
    CGPCRREMPNIVEAYAKYKGKNFEIVGVSLDQDADKWKDAIKKLNITWPQMSDLK
    GWQNEGAQLYAVNSIPHTMLVDADGTILARGLHGEKLQTKLEEVLNK

    >gi|53714055|ref|YP_100047.1| putative thiol peroxidase [Bacteroides fragilis YCH46]
    MATTNFKGQPVKLIGEFIQVGKVAPDFELVKSDLSSFALKDLKGKNIVLNIFPSLDTGVCATSVRKFNKMAAGMKDTVVL
    AISKDLPFAQGRFCTTEGIENVIPLSDFRFSDFDESYGVRMADGPLAGLLARAVVVIGKDGKVAYTELVPEITQEPDYEK
    ALAAVK

    >gi|53714447|ref|YP_100439.1| hypothetical protein BF3160 [Bacteroides fragilis YCH46]
    MKYLYVLLAFSFLFSCKDENKKHAESVLREWMNKEIVFPNKMYFSIQGKENVDFRIKDTEYKIVAYVDSAGCTSCKLHLS
    KWKELIHYVDSIQSERVQFLFFFFPKNGRDIYHTMRMDKFTYPVCVDTLDSFNKLNHFPDDVRFQTFLLNKENKVVAVGN
    PIHNPNIRDLFLNIISGGTSLPDEKRPQTEVKIEALSMDLGMFDWKKEQKCIFTVQNTGKELLVIDDVNTS
    CRCTTVEYS
    REPVQSGKTVDITVVYKAEYPEHFNKTITVYCNSPVSPLQLKIKGDAK

    >gi|53714462|ref|YP_100454.1| thioredoxin [Bacteroides fragilis YCH46]
    MEKFEDLIQSQSPVLVDFFAEWCGPCKAMKPILEDLKQQVGEKARIVKIDVDTHEELAVKYRIQAVPTFILFKKGEAVWR
    HSGMIQASELKGVIEQYT

    >gi|53714463|ref|YP_100455.1| thioredoxin [Bacteroides fragilis YCH46]
    MKKVLSLVALAMISTIMFAVNDGVKADQNKKEAKSGEVIVMNKEMFINDVFDYQNSKEWKYKGDKPAIIDLYADWCGPCR
    MTAPIMKSLAKEYDGKIVIYKVNVDKEKELAALFNATSIPLFVFIPMEGEPQLFRGAADKATYKKAIDEFLLKQK

    >gi|53714480|ref|YP_100472.1| thiol:disulfide interchange protein DsbD [Bacteroides fragilis YCH46]
    MKKLSSFLLLLLVVFTAQAQIQEPVKFKTELKTLSGAEAEIVFTGTIDAGWHVYSTDLGDGGPISATFNVEKMSGAEVVG
    KLTPRGKEVSDFDKLFEMKVRYFEKTAQFIQKIKFTGSDYSIEGYLEYGACNDENCLPPTQVPFKFSGKAATTAEVSAKE
    TPATPVKEPVATVTDSIVEPVATTVTTAIGSVDLWKPVINDLKKFGEANSQEDMSWIYIFITGFLGGLLALFTPCVWPII
    PMTVSFFLKRSKDKKKGIRDAWTYGASIVVIYVALGLAITLIFGASALNALSTNAVFNILFCLMLIVFAASFFGAFELTL
    PAKWSTAVDSKAEATSGLLSIFLMAFTLSLVSFSCTGPIIGFLLVQVSTTGSVVAPAIGMLGFAIALALPFTLFALFPSW
    LKSMPKSGGWMNVIKVTLGFLELAFALKFLSVADLAYGWRILDRETFLALWIVIFALLGFYLLGKIKFPHDDDDTKVSVS
    RFFMALVSLAFAVYMVPGLWGAPLKAVSAFAPPMKTQDFNLYTNEVHAKFDDYDLGMEYARQHNKPVMLDFTGYG
    CVNCR
    KMELAVWTDPKVSSIINNDYVLITLYVDNKTPLTEPVKIMENGTERTLRTVGDKWSYLQRVKFGANAQPFYVLIDNEGNP
    LNKSYAYDEDISKYINFLQTGLENYRKEK

    >gi|53714505|ref|YP_100497.1| thiol:disulfide interchange protein [Bacteroides fragilis YCH46]
    MKHILFTLALASIAGIANAQHNGHSYTVEGLINDSTLNGQTLYISRYDDGMKVDSTQVTNGQFKFTGKADIPCFCRIDAG
    REYANFILEGGNIQVNVLTHNDPKGTPMNEEYTHISDKTSELVTELRKRHAAIEQQTEDKSEQLRLKKEYADTYWHPTYT
    RLYKDMFMKNPDNALGEFAIRELAMCALPEEMDTIFAASGPWLKSLSVYHRIEKQFQGMKATAVGQKFTDFSGKTIDGTA
    SSLSDFVGKGQYTLVDFWASW
    CGPCRSESPHIAELYNTYKDKGLTVLGVAVWDKPENTKKAIKELNIDWPQIIDTGMTPM
    DLYGVKGIPFILLFGPDGTIIARDLRGEGMKNKVAEVLNNK

    >gi|53714507|ref|YP_100499.1| thiol:disulfide interchange protein [Bacteroides fragilis YCH46]
    MNTIFKTTGLCVFLFTCTPWATAQNFSIDYPSYQKRNTDALEISRIVRNDTATILYMDAYSRPNYWIRLASELSLHGVQS
    GKKYPVIRSQGFELDKQVYMPASGNVTFTLQFAPIDPQDRTIDFVESNNEEDFRIEGICLDASVPKKKVHCHLAGKMANR
    PQTSRLILIESNKNTRGTPWISIPVRNGVFEYDFYTDHEKAYELICWDDLLNGCWYPVTFFAENGTVSFTISAIDARPPY
    RIETLNPLTTALRLFEAEGEDKFSFDELNARRDTLEKYGRFESEAMQALWKKFDQVKDNPEERNKLFRERDRLEESGEAF
    TEEAKALIKEREQLFRKKVIWETEQASQHPSLVGLFILKMKVENARKDEDVIPYLEVFQKVYASRYPEHPYTREMQMFID
    NNQPKTGNRFIDFSAPDLNGNMVQLSEQIRGKVALIDLWASW
    CGPCRTTSKQLIPIYEKYKDRGFTVIGVAREQNSDIRM
    REAIRKDGYPWLNLIELNDVQQIWSKYRIPNAAGGTFLVNAQGIILAVNPTAEEVERILQKEL

    >gi|53714624|ref|YP_100616.1| putative methylated-DNA methyltransferase [Bacteroides fragilis YCH46]
    MKDYKENKSNLSETFCNEVYSVVREIPAGSVTTYGDIAALLGMPQYSRMVGRALRQVPAGLNLPCHRVVNAIGRLVPGWD
    EQRRLLDAEGVSFRKNGCVDLRLHRWRDDSVLAD

    >gi|53714669|ref|YP_100661.1| putative thiol:disulfide interchange protein [Bacteroides fragilis YCH46]
    MKSKLLFLLLLLGSSYITAQTVIENPPFETRQGSIHTISKIELSPTETRLTIRTVFRPQWWTSLDSLTYIYVPESKKQLY
    PLRIEGRKFGEQVTTPASGIIEDDCVITYPPLPEGTTRIDWMDDNLNSETNTYGILLVKPQETKEQASLRKIHGNWQQAD
    AQNGWDIGIYDSLAIMDNRFWKYDLCRKQGKKFKLNLKDETGEQCLLEITQEKDGNLCIGKNGGKANKYIRAGRPQRNYA
    ATTAATAPQTAFFRKDTVHIRGFLDGYSPKLGFTTVLIYTDNHITNEGTPAVVTIHPDGRFESDFVVNYPGVHHLSMGNN
    WMTFYIRPGETLMLYINWEDHLDYLRQRRLKPMLTETLYMGPSSSINQELMPCEPLFSKDYHIIQNACKTLIPSEFKTQQ
    EPMYKLWMHRVDSLEQSKTLQPEAMQMLKNDVMINYGAWLLEFILMRDMDARKDTTNTILKIKETPDYYDFLKAMPLNDV
    RSIGCNNFSTFINRIEFMNPFLPASWQIKNGTDDRMEKYAESWRKKKEILQDTTGMPFPVVGELILTRSYPFLAKTLENE
    KKAFALLDTLKGYLHDPFLVAEAERMYRQVYPVQGNKPQELPAGKGTDIIRKLTAPYLGKFVIIDFWATS
    CGPCRASIEQ
    HADLRKEYRNSPDIKFIFVTSNQDSPEKAYENYVEKHLKEETIFRLPQSDYNYLRELFHFNGIPRYVLLNRDGKLLDENF
    PMYNIELFLKESKIRKE

    >gi|53714810|ref|YP_100802.1| thiol:disulfide interchange protein [Bacteroides fragilis YCH46]
    MKSILLSVISFLLVMNVCGKNDVDMRTYLKKVLGNLGKIESASYHEQSQSWQPGDTVAITNFHRFIKEYTNPSDSTIGAS
    YVCLDAKDTTRFEFGYDGNVRMISYHEHKGIMIDDFTTRSLPFRLVAPPFFCYTRNIIGYALSTGDSITTEWKDLGEAYY
    FKLVIHEDRQVEFFGKAYYIPKPPFDLGDPTSIYELWISKADGLPYKMRREMSHQISATTCSDVVLNQLSIAGLNLYDYV
    PQDYEIRKYGEQKKVTQPAATDLIGQKAPDWMLKDMYEKPVALSEFKSKVLLVNLTGIG
    CGACHASIPFLNGLKGKFNAG
    EFEVVSIETWGREPHSLRTYADKNQINYSFLCGDEGIVKSYRTYGAAPLFFILDQDRVIRKVIRGYRMGRTDEEITDAIK
    ALL

    >gi|53714858|ref|YP_100850.1| bifunctional methionine sulfoxide reductase A/B protein [Bacteroides fragilis YCH46]
    MKKKFTIFVMLLAGIIYTGHAQDVQWIYQQKQEKKNMKNLSEIYFAGGCFWGTDHFLKQIRGVKSTQVGYANGNIANPTY
    QQVCTGKTNFAETVKVEYNPQEVPLKLLIDLFFKTIDPTSLNRQGNDKGSQYRTGIYYTDEADLPTIRTAIDELAKEYSK
    PIVIEVKPLSNFYKAEEYHQDYLDKNPGGYCHINPALFELAKKANAQAEQSQTNYKKTDDATLRSKLTPEQYAVTQKNAT
    EPAFHNEYWDEKRDGIYVDITTGEPLFISTDKFDSGCGWPSFTKPIEKEVIKEKMDTSHGMIRTEVRSKTGDAHLGHVFT
    DGPKEKGGLRY
    CINSASLRFIPKEKMKEEGYGEYLKLLPQK

    >gi|53714868|ref|YP_100860.1| arsenate reductase [Bacteroides fragilis YCH46]
    MKTLFLQYPACSTCQKAKKWLTENNIEYTNRLIVDDNPTVEELKAWIPLSGLPVKKFFNTSGVVYKELKLSSKLPTMTEE
    EQIALLATNGKLVKRPLVVTERFVLVGFKPEEWEKLK

    >gi|53715115|ref|YP_101107.1| hypothetical protein BF3831 [Bacteroides fragilis YCH46]
    MKKLLLILLLVLAGEISAQQAATIVVKTTPDNEIAYWPTGKEHLFCIALGTKAQAGPLGEFVHQFRTDRPGMVQVWTQGS
    DSFTLYLTPGSKDTITVTKDTLIISGTNSAYNRCLKTVNDYQKYSDKLVYMQPHELRGITSLEQYHRLADARMRQALDAV
    NASGLNEEFLAEQRAHIDYIRRSIFIHIARQLSRKEKLPEDWQRELTEVINSSVNGDYLRSYRGIGFFVNDLVMMQFTNL
    ENGDLKEIKDYASFLFDRYRKFFTGDNLQYMQAQLIYEDEFQGSKTPSIPQLYETYKAEFPNSPFLNVLEPGVKENLRFQ
    NSRITDKDYHILTCDSTITSLEDAVKPFKGKVVYIDVWATW
    CGPCLKEFQYLPALKEKAHNMDVVYLYISIDRPEERKKW
    EKTIAYHQLKGYHLLVNEKLGKSLYTELGNERQILSIPCFVIIDKTGKIVIRHAAAPSEPEKVIEQLSTYYNK

    >gi|53715170|ref|YP_101162.1| glutathione peroxidase [Bacteroides fragilis YCH46]
    MKAFFSFVAALVLSLSMAAQNKSFYDFTVKTIDGKEYPLSGLKGKKVLVVNVASKCGLTPQYAELQELYDQYKDQNFVII
    GFPANNFMGQEPGTNEEIAKFCSVNYDVTFPIMAKISVKGKDMAPLYHWLTEKKLNGKQDAPVQWNFQKFMIDENGNWVG
    FVAPKESPFSETIISWIEKK

    >gi|53715277|ref|YP_101269.1| putative thiol:disulfide interchange protein DsbE [Bacteroides fragilis YCH46]
    MKKITFIAILLLCICSLTKAKEKVIEQPPFIAWTSTSIQVDKVVLSDTATVLYIKAFYHPKQWIRISGQSFLKDNNGETY
    ALRSGIGIKPDTEFWMPESGEGEFRLVFPPIPTSATSIDFSEGDNVQGAFKIWGIQLKGKALPELLLPQEAIVHKIDIND
    ELPEPKIEYKDATIKGRILDYRPGLVSKIVPIIFDPVKGAYESEEVKINNDGTFVTRVKVPTTTSAAIRLFGKMITFYAV
    PGEESSVIINTRELCRQQSKLHKDDKPYGEAVYFGGTLAGLSQEYSNCTLKTSILNDYRQLFKDVAGMDAGAYKDFIYGK
    RANLLASIEKAPISKALKAVLGNQVDAEAAQAISLTEMVIKQAYTMEHKMSKEEAKEYFNTAQIELPENYYANAFRPLAS
    INTMAALYNSKLSELIPYYLRRRTDELTKAWGTDKGIYFDINKAGELYSSIKEFTPLTAEQEVILATLPPACQNEVRDAN
    NQLLKTLEANKKKTGFTINEVGDVSNEELFSSIISKYRGKVILVDFWATW
    CGPCRMANKAMLPLKEELKGKDIVYLYITG
    ETSPLKTWENMIPDIHGEHFRLTDAQWSFLGDKFDIRGVPTYLIIDREGNVKHQKTGFPGVAQIKEELMKVYD

    >gi|53715584|ref|YP_101576.1| methylated-DNA-protein-cysteine methyltransferase [Bacteroides fragilis YCH46]
    MENVIQIQYYQSPCGELILGAYREKLCLCDWKIEERRIIIDRRIQKELQASYKEGISEVITRTIGQLDEYFAGRRTTFDI
    PLLLVGTDFQKTVWNELLNIPYGKTISYAGLSQKLGNPKAIRAIASANGANPISILVP
    CHRVIGSDRKLVGYGGGLPAKK
    ILLDLESSDRLF

    >gi|53715765|ref|YP_101757.1| hypothetical protein BF4486 [Bacteroides fragilis YCH46]
    MRKIGLLFITIFCLLACKNNSSRISLEGEIKGLTNDTLYLYGTDALYDRIDTIYAEKGKFSYNLNIDSTVIDTLTTAVLL
    INGHVEYPVFLDKGNQITIKGNIDDLSYLDINGNEPNTSLSLFMKEQRGLGSASDKMMQEKAETFIRQHNSSLASVYLLD
    KYFVQTPQPDYIKIKEITEAMTGALLDRPYIENISDYIDQLEKVTVGKSAPYFSLPNEKGEKLSRSAERFRNRYLLLNFW
    ASW
    CDPQPEANAELKRLNKEYKKNKNFAMLGISLDIDREAWETAIKKDTLSWDQVCDFTGLSSETAKQYAILTLPTNILL
    SPTGKILARDIQGEALTDKLKELLKTEEKKPGKSIR

    >gi|53715778|ref|YP_101770.1| hypothetical protein BF4499 [Bacteroides fragilis YCH46]
    MIDEWDGKEIIYPDDLVFTTMGEDTVKWFLKDSRYTIVTYADSIGCMGCKLKLPAWKDFISYLDSVSDHTVKVIFILHPR
    DKKEMVHLLEYNDFSYPVCLDIKGSFDKINKIPSNLAFQTFLLDNRNKVIAIGNPIHNPNVRTLYLNLILSDSICESRDL
    IQTKISLPETIDMGVFDWSEEKEAMLIIKNLGVVSLTVENIVTS
    CGCTSVEYSRRPVSLKDSLVIKIKYKAESPGYFNKD
    IAIYCNVLSSPVYVKLSGKAQ