Yersinia pestis biovar Microtus 91001 uid58037

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|45439882|ref|NP_991421.1| periplasmic protein disulfide isomerase I [Yersinia pestis biovar Microtus str. 91001]
    MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFFSFYCPHCYQFEEVYQVPKAVKKALPEGTKMTRYHV
    EFLGPLGKQLTQAWAVAMALGVEEKITPLMFEGVQKTQTVQTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAA
    EDLQLRGVPAMFVNGKYMIKNDGMDTSSMDNYVKQYADVVTFLLTQK

    >gi|45439929|ref|NP_991468.1| hypothetical protein YP_0065 [Yersinia pestis biovar Microtus str. 91001]
    MLQEIMQFISQHPILSLAWVLLFGAVVFTSFKNSLSKVKEVTRGEATRLINKEDAVVVDIRTREDYRKGHIANSINLIPS
    DIKNGNLGELEKHKTQPIIVV
    CAMGTTSRASADMLSKAGFERVFTLKEGISGWSGENLPLARGK

    >gi|45439930|ref|NP_991469.1| glutaredoxin 3 [Yersinia pestis biovar Microtus str. 91001]
    MAKIEMYTKATCPFCHRAKALLNAKGAAFHEIAIDNDPAKREEMIARSGRTTVPQIFIDGQHIGGCDDLHALDARGGLDP
    LL

    >gi|45439936|ref|NP_991475.1| bifunctional regulatory protein/DNA repair protein [Yersinia pestis biovar Microtus str. 91001]
    MNNVKDPRWAAIINRDKTADGQFVYAVKTTGIYCRPSCPSRRAKAENIEFFIDNTAAEQAGYRPCKRCQPTQLSRAQQQV
    EKISQACRLIELAETPPKLNELAAQLGLSTFYFHRLFKAITGLTPKGYANATRSERIRAQLSHGGSVTDAIFEAGYNSSS
    RFYAQSQQLLGMTPTRYRKGGCDARLHFAVGESSLGAILVAKSELGVCAILLGDDPVRLVQQLQDKFPQANLVGGDAEFE
    QWVAQVVGCVEAPKLGLNLPLDIRGTAFQQRVWQALREIPIGETASYADIASRIGSPTAVRAVAGACAANILAVAIP
    CHR
    VIRQDGALSGYRWGVERKRLLLEREGVEKEAEDH

    >gi|161511474|ref|NP_991526.2| thiosulfate sulfurtransferase [Yersinia pestis biovar Microtus str. 91001]
    MEQFEAISVEQAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTNSSLHTFMQQTDFDQPVMVMCYHGNSSKGAAQYLLQ
    QGFDVVYSIDGGFEAWARSYPQDITSESR

    >gi|45440128|ref|NP_991667.1| dihydrolipoamide dehydrogenase [Yersinia pestis biovar Microtus str. 91001]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETILVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKVRVWKDKVINQLTGGLAGMAKGRKVKVVTGFGKFTGANTLVVDGENGPTTINFDNAIIAAGSRPIQLPFIPHED
    SRIWDSTDALALRTVPERLLVMGGGIIGLEMGTVYHALGSKIDVVEMLDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIHVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGMKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKL
    IFDKETHRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKK

    >gi|45440157|ref|NP_991696.1| iron-sulfur cluster insertion protein ErpA [Yersinia pestis biovar Microtus str. 91001]
    MGVMRMSNETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFDDQVNDGDMTIEKQGVELVVDPMS
    LQYLVGGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|45440284|ref|NP_991823.1| putative inner membrane protein [Yersinia pestis biovar Microtus str. 91001]
    MSWPEFKSQYLVRFWAPLPAVIAAGILATYYFGLTGTFWAVTGEFTRWGGHIMQLFGAQPQEWGYFKVIGLEGTPLDRID
    GMMIIGMFAGCIAAALWANNIKLRKPQHTIRIAQALVGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFALATAAGSY
    FGAKFTLLPLFRIPIKLQKVTAASPLTQHPARAARRFRLGMVVLVLALGWSLIELFRQPKLGIAMLCGIGFGLLIERAQI
    CFTSAFRDLWITGRTHMAKAIILGMAVSTLGIFSYVQLGVEPKILWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    IHYWWVGLGNIIGATLLAYYWDDFAPALATNYDKVNLLETFGPMGGLLVTYLMLALAFAAMLWWEKRFFRKQKATTSALI
    KESL

    >gi|45440353|ref|NP_991892.1| thiol:disulfide interchange protein precursor [Yersinia pestis biovar Microtus str. 91001]
    MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPVDQAFAFDFHQQGDQLNLSWQIHPGYYLYRQQIKIV
    PQQAALGAFTLQEGITHHDEFYGEVEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTAS
    GTAAVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVILGREKPHSQRRILILAVVY
    VQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVLLALSMFGLYSLQLPSSLQTRLTQWSNSQRGGSLAGVFAM
    GALAGLICSPCTTAPLSAILLYIAQSGNMLAGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILALP
    VFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPLQDWAFNGNTQQNAVKHINFQPV
    ANLPQLQAVLAQAQGKPVMLDLYADW
    CVACKEFEKYTFSDDKVQRQLANTLLLQADVTANNAEHATLLKKFNVLGLPTIL
    FFDSQGNEITAARVTGFMDAAQFLQHLQNTPAVTK

    >gi|45440412|ref|NP_991951.1| methionine sulfoxide reductase A [Yersinia pestis biovar Microtus str. 91001]
    MQNVDNTAVIDAANALPGRLTSIPVSPLHAVHGHSMTYIPEGMDLAFFAMGCFWGAERLFWQQPGVYSTAAGYSGGHTPN
    PTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQEEQAHKSRERFQQA
    MEKAGDQRVITSEITVALPFYYAEDDHQQYLHKNPHGYCGLGGIGVCLPPNV

    >gi|45440512|ref|NP_992051.1| thioredoxin 2 [Yersinia pestis biovar Microtus str. 91001]
    MNTVCTACMATNRLPEERIDDGAKCGRCGHSLFDGEVINATAETLDKLLQDDLPMVIDFWAPWCGPCRSFAPIFAETAAE
    RAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAVPKAPFDNWLDEQLSRDPNS

    >gi|45440546|ref|NP_992085.1| Na(+)-translocating NADH-quinone reductase subunit D [Yersinia pestis biovar Microtus str. 91001]
    MADSKEIKRVLLSPLFDNNPIALQILGVCSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHIPNSVRIIVQMVIIA
    SLVIVVDQVLRAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVGFVRELVGSGKL
    FGVTVLETVQNGGWYLPNGLFLLAPSAFFIIGLLIWGLRTLKPAQIEKE

    >gi|45440547|ref|NP_992086.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis biovar Microtus str. 91001]
    MTMEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFL
    NFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALA
    GIREKMKYANVPAGLQGLGITFISTGLMALGFMSFAGVNL

    >gi|45440586|ref|NP_992125.1| putative alkyl hydroperoxide reductase subunit c [Yersinia pestis biovar Microtus str. 91001]
    MVLVTRQAPDFTAAAVLGNGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGIVRSQIVNDLPIGRNIDEMIRTVDA
    LQFHEEHGEVCPAQWEKGKAGMGASPDGVAKYLSENASKL

    >gi|45440650|ref|NP_992189.1| hypothetical protein YP_0801 [Yersinia pestis biovar Microtus str. 91001]
    MHSLVIIANGAAYGHESLFNALRLSIALKEQQTDLDLRLFLMSDAVIAGLNGQQPREGYNLQQMLEILTAQNVPIKLCKT
    CADARGIAGLTLVDGVEIGTLVELAQWTLAAEKVLTF

    >gi|45440681|ref|NP_992220.1| copper exporting ATPase [Yersinia pestis biovar Microtus str. 91001]
    MLQTTLLALQGLSCMNCAQRVKAALESREDVHHAEVNVHYAKVTGEADTHALIETIKQTGYQATEAQTPDVELHLSGLSC
    GHCTETVRKALEAVSGVISADVTLESANVYGKADIQTLIAAVEQAGYHATQQGIDSPKTEPLTHSAQSQPESLAAAPNTV
    PATNVALATSTVSDTNTVLPTNTALPTNTTSTTSTADTASATSTAPVINPLPVTESVAQPAASEGESVQLLLTGMS
    CASC
    VSKVQNALQRVDGVQVARVNLAERSALVTGTQNNEALIAAVKNAGYGAEIIEDEGERRERQQQMSQASMKRFQWQAALGL
    LLGIPLMAWGLFGGSMTLTPETQTPWLIIGIITLLVMIFAGGHFYRNAWVSLKNGSATMDTLVALGTGAAWIYSITVNIW
    PDVFPMEARHLYYEASAMIIGLINLGHAMEQRARQRSSNALERLLDLAPPTAKLVTDDGEKVIPLADVQLGMILRLTTGD
    RVPVDGEIVQGEVWMDEAMLTGEPIPQQKSVGDIVHAGTQVQDGTVQFRASAIGSQTTLARIIKLVRQAQSSKPEIGKLA
    DRISAVFVPTVVVIAIVAGLIWYFFGPQPQLVYTLVVATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQQ
    ASNLDTLVFDKTGTLTEGHPQVVAIHTFNGVSEQQALGWAAALETGSNHPLARAILQRAEGLTLATASQFRTLRGLGVSG
    EVDGIPLLLGNNRLLEEQQIDTRELQSLIQQQAESGATPVILTANGKPAALLSIRDPLREDSIGALQRLHQLGYSLVMLT
    GDNPITANAIAKEAGIDRVIAGVLPDGKADAIKQLQAAGHKVAMIGDGINDAPALAQADVGIAMGGGSDIAIETAAITLM
    RHSLYGVVDAVELSKATLRNMKQNLLGAFFYNALGIPIAAGILYPFTGTLLSPVVAGAAMALSSITVVSNANRLLRFKPK
    Q

    >gi|45440685|ref|NP_992224.1| putative thioredoxin [Yersinia pestis biovar Microtus str. 91001]
    MLTPTTIEITEANLHQAIEQSMSVPVLFYFWSERSQHCLQLTPTLDKLAAEYAGQFILARVDCDAQPMVASQFGLRSIPA
    VYLFKDGQPVDGFQGPQPEEVIRELLQRVLPKPEELKSAEAAQLMSEGKVPEALPLLKEAWQLAQQSNSPQTSEIALQLA
    EAQILLNRSEDAESVLATLPLQDRDTRYQGLIAQIELLKQAANTPEIQQLQQQLAEQPDNVELAVQLALQLHQVGRNEEA
    LELLLGHLKKDLAAANGTARKTLMDILAALGTGDALAAKYRRQLYALLY

    >gi|45440780|ref|NP_992319.1| putative sulfurtransferase [Yersinia pestis biovar Microtus str. 91001]
    MNSDFLVTPQWLAAHANDANIVILDARMSPPGVVPKRNIQAEFEQGHIPGAVYFDIDAIADHSTGLPHMLPSPQLFSEMA
    GQLGITEQHTVVIYDEGNLFSAPRVWWTFRTFGAKNVRILASGLSGWQQAGYKLESGPAHPTPQTFNVTFNAAAVSSVDE
    VLAVLGNNEVQILDARPSARYRAQEPEPRPGLRLGRIPGSINIPWGTMVENGHLKSPQALAEIFAAQGVDLTKPIITS
    CG
    SGVTAAVVVLGLAAVNARSVSLYDGSWAEWGASNSLPIDATPLA

    >gi|45441046|ref|NP_992585.1| thioredoxin reductase [Yersinia pestis biovar Microtus str. 91001]
    MSTAKHSKLIILGSGPAGYTAAVYAARANLKPVLITGMEKGGQLTTTTEVENWPGDPEGLTGPALMERMHEHAEKFQTEI
    IFDHISSVDLQNRPFRLFGDGAEYTCDALIIATGASARYLGMASEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLANIAAEVHLIHRRDTFRSEKILIDRLMEKVKNGNIVLHTDRTLDEVLGDDMGVTGVRLKSTHSDETEELAVAGVF
    IAIGHSPNTGIFSDQLALENGYIKVQSGLQGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLANDK


    >gi|45441092|ref|NP_992631.1| glutaredoxin 1 [Yersinia pestis biovar Microtus str. 91001]
    MFAVIFGRPECPYCVRAKELAEKLASERDDFKFRYVDIHAEGISKADLEKTVGKPVETVPQIFIDEKHIGGCTDFEAYAK
    EHLSLYK

    >gi|45441209|ref|NP_992748.1| molybdopterin biosynthesis protein MoeB [Yersinia pestis biovar Microtus str. 91001]
    MPFITLSEVDMLPELSDVEALRYNRQITLRGFDFDGQEKLKAAKVLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDTVALS
    NLQRQILHRDSRIGMTKVASAAQTLSEINPHLALNTLDKQLDDEQLLSLIAEHQLVLDCTDNLSTREQLNRLCHTLGKPL
    VSGAAIRMEGQVSVFTYQDNQPCYRCLSRLFGDTALT
    CVEAGVMAPLVGIIGNLQAMEAIKLLANYGQLVSGRLLMYDAM
    TAEFRSITLAKDPLCEVCQSDRRSPL

    >gi|45441491|ref|NP_993030.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis biovar Microtus str. 91001]
    MDDLGVCVMTESYLTIFIRAVFVENMALNFFLGMCTFLAISKKVETAFGLGLTVTALLAIATPLNNLIYTYILRENALID
    GVDLSFLDFITFIGVLAALVQILEMVLERFLPSLHHTLGAFLPLLTIH
    CAIFGATIFMVQREYTFTESFVYGTGCGLGWM
    LAIISMAGLREKMKYSNIPKGLQGLGIVFMTAGLMSLGFMSFSGIRL

    >gi|45441505|ref|NP_993044.1| putative thioredoxin-family protein [Yersinia pestis biovar Microtus str. 91001]
    MVNILMKRAAIMWRNLKIIGLCSLLLLLSACKQEKVALGEVAPTLAAYDLQGEAVALEQWEGKLVYLNFWSVNCGGCLAE
    MATLNQLSQEYQDQAVVVAINTDPEQVEIAPVLAQHNINYPVIRDQLGITQERYQVIGTPTSFLIDRNGKVIEWHQGVRN
    EQELTALFKQKVSEKQ

    >gi|45441659|ref|NP_993198.1| putative rhodanese-like protein [Yersinia pestis biovar Microtus str. 91001]
    MLQRWILSTNFPVKNEVIMSAIEQLSYYQKKLAYETDSWDLYLALKNSENVVVVDGRSKEVYQREHIPGAINQPHKEICF
    NNTEKLDKTKIYICY
    CDGIGCNASTKTAMKLMTLGFQVKELLGGLDWWKRDGYSTEGIEGKEGTPISCGC

    >gi|161511387|ref|NP_993284.2| disulfide bond formation protein B [Yersinia pestis biovar Microtus str. 91001]
    MLQFLNRCSRGRGAWLLMALTAFLLELTALYFQHIMLLQPCVMCIYERVALFGILGASLLGAIAPRSPLRYLAIAVWIYS
    AWKGVQLAWAHTMLQLNPSPFNT
    CDFFVNFPSWLPLDKWLPAVFAASGDCSERQWQFMSLEMPQWLVGIFAAYLVIAVLV
    LISQFVKPKRRDLFGR

    >gi|45441759|ref|NP_993298.1| methionine sulfoxide reductase B [Yersinia pestis biovar Microtus str. 91001]
    MLLLDVVFVDFIPCQRTAKMAKELNPTENIEKLSDIQRYVTQERGTEAPFTGKLLHNKRDGVYQCLCCHQPLFISESKFD
    SGCGWPSFYQPIDADSIRYIDDYSHNMHRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CINSASLNFVDDQNGEQTAG

    >gi|45441765|ref|NP_993304.1| selenophosphate synthetase [Yersinia pestis biovar Microtus str. 91001]
    MASPAIRLTQYSHGAGCGCKISPKVLDKILHTEQQKFFDPRLLVGNETRDDAAVYDIGNGVGIISTTDFFMPIVDDPFDF
    GRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEIAQQVIEGGRYVCQQAGISLAGGHSIDAPEPILGLAVTGIVSTE
    QVKKNSAAKPGCKLFLTKPLGIGILTTAEKKSKLRPEHRGLATETMCQLNKPGADFAHIPGVTAMTDVTGFGLLGHLSEI
    CQGSGVQAILHYSAIPRLPAVEDYIAEGCVPGGTGRNFDSYGHLIGNMSDLQKQLLCDPQTSGGLLLAVLPDAEADVQAI
    AAQHGMTLSPIGELTSADSRRALIEIVV

    >gi|45441838|ref|NP_993377.1| electron transport complex RsxE subunit [Yersinia pestis biovar Microtus str. 91001]
    MSEAKNLLAQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNTAVSALRRWVPSEIRIPIYVMIIASVV
    STVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVIGRAEAYAAKNPVGLSALDGFAMGMGATCALFVLGALREILGNGTLFDG
    ADMLLGSWATVLRIDILHLDTPFLLAMLPPGAFIGLGLLLAGKYVIDEKMKARKANTRVSVPQLQDGDAEKAL

    >gi|161511380|ref|NP_993383.2| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia pestis biovar Microtus str. 91001]
    MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLIYLRTLAFILV
    IAVVVQFTELVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAV
    ADVPAPFRGSSIALITAGLMSLAFMGFTGLVKF

    >gi|45441879|ref|NP_993418.1| methylated DNA-protein cysteine methyltransferase [Yersinia pestis biovar Microtus str. 91001]
    MKLLRNHYGADTFTLVEKRNPGGLSESMQRYFAGELSIIDTLPVKTAGTDFQRQVWQELRKIPCGETISYGELAKRINRP
    TASRAVGMANGLNPISIVVP
    CHRVIGSQGALTGYAGGVDRKRWLLVHEGYLLGC

    >gi|161511374|ref|NP_993461.2| thiol peroxidase [Yersinia pestis biovar Microtus str. 91001]
    MTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVV
    LCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGVAITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYD
    AALAALK

    >gi|45441941|ref|NP_993480.1| hypothetical protein YP_2149 [Yersinia pestis biovar Microtus str. 91001]
    MVQFRRRNNAHWYHETQCSGSLEHCSGSPVNISTTVNVPTTVNNENPPVDIRPRDPSESDNMSTGSNITEQSIITEQGIF
    LLGVTENIAPTLQDTLYHEQPILTASDAMYQALFPTIIEINHTNTFSLYDRLSTALTVAQVTGIQRLCSHYALRLAPLPS
    PDASRESNIRLTQITQYARQLASQPTLIDRHALAQLHDVGLTDSDIIILSQIIGYVGYQARVVAGISALAGYPTVMLPGF
    PRMEDAAPSPLPDVMPNWQGWLPSHAANDDQPDKEPDETASTLTELLGHHQQSLLAYHAITTHQPNSPQLQRDWLELVAL
    VSARINGSLY
    CQARHRQHLQQLTEPPLLVTELLKGIDHALFLLPEQQIPHQLISVTAELTRAPERFNHQHVKRLQTLGVS
    DTQVMRIIFSIAITGWTNRLRHTLGK

    >gi|45441961|ref|NP_993500.1| hypothetical protein YP_2169 [Yersinia pestis biovar Microtus str. 91001]
    MRKQEMTTIDKIQRQITENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWV
    DGELVGGCDILMEMYQRGELQTLLKETADKYRSQEDQPAAE

    >gi|45441982|ref|NP_993521.1| iron-sulfur cluster assembly scaffold protein [Yersinia pestis biovar Microtus str. 91001]
    MIEKHKVEHMQQESVGTFSLDDNDWQGVTITDSAAAQITRLMQQDPQIKGLQLGVKQSGCAGFAYVMDMAKEPASDDLVF
    EQGSARLYVPLKAMPFIDGTEVDYVREGLNQIFKFNNPKAQHSCGCGESFGV

    >gi|45442001|ref|NP_993540.1| putative glutathione peroxidase [Yersinia pestis biovar Microtus str. 91001]
    MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEVLGFPSNEFAGQEPGSDEEIH
    AFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVKPEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLA
    RFAPDMAPEAPILINAINQALASH

    >gi|45442061|ref|NP_993600.1| hypothetical protein YP_2271 [Yersinia pestis biovar Microtus str. 91001]
    MNSNQFLSVTSSKDRTYTMPVLHNRISNEELKARMLAETEPRTTVSFYKYFTLEDAKTFRDNLYSQFVKLGVFGRVYVAK
    EGINAQISVPANRYDEFKIALFASHPALDQVRLNVAHEDDGKSFWVLRLKVRERIVADGIDDDSFDPANIGHYLKADQVN
    QMIDDPDTLFVDMRNHYEYEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMY
    CTGGIRCEKASAYMLHNGFKNVY
    HVEGGIIEYARKAKEQGLPLKFIGKNFVFDERMGERISDDVIAHCHQCGTPCDAHTNCKNDGCHLLFIQCPVCAAKFEGC
    CSQICQEELKLPQEEQRSRRAGRENGIKIFNKSKGLLQATMHIPSPEKSADEK

    >gi|45442213|ref|NP_993752.1| thiol:disulfide interchange protein DsbE [Yersinia pestis biovar Microtus str. 91001]
    MKPQSSFNKLMFIPLVLFLLLVVAFLIQLTRNANGEDPTMLESALIGKPVPAFKLESLEQPGKTFDQAVLRDGKPILLNV
    WATW
    CPTCRAEHEYLNKLAAQGIRVVGLNYKDDRSKAVQWLNSLGNPYFLSLYDGDGMLGLDLGGYGAPETFLIDGQGVI
    RYRHAGDLNDRVWQQEILPLYKKYQGGA

    >gi|45442238|ref|NP_993777.1| putative glutaredoxin [Yersinia pestis biovar Microtus str. 91001]
    MSIIIYSKPDCVQCNATYRAFDRQGISYQIIDLTEDEQALNHVKSLGYQQVPVIVAGDEHWSGFHPDKINALVQAVSV

    >gi|45442340|ref|NP_993879.1| iron-sulfur cluster assembly protein [Yersinia pestis biovar Microtus str. 91001]
    MSISISDSAAQRVSAFLNHRGKGLGLRLGVRTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVIIDGKSMVYLDGTELDFV
    KEGLNEGFKFNNPNVSNECGCGESFNV

    >gi|45442403|ref|NP_993942.1| putative pyridine nucleotide-disulphide oxidoreductase [Yersinia pestis biovar Microtus str. 91001]
    MGKTIVIVGGVAGGASAAARLRRLNEYDNIIILERGEYISFANCGLPYYIGGVITERDKLLIQTPEKMKDRFNIDVRTEN
    EVVDIDSASKTITVINHKVGKEEFIQYDTLILSPGARPFIPDIAGLSVNGPVFTLRNMSDTDNIKAYLISATPEAVTVIG
    GGFIGLEMAENLVSSGLKVTIIELSNQILSPLDYEMAAIVEKHLKDNGIDVIKNDAVVQFDESAHQIHLKSGKIITTDMV
    ILAIGVEPENDLAKKAHLDLGIRGSILVNEKLQTSVADIYAIGDAIQVVDYINGQATYIPLAWPANRQGRLLADIINGRD
    VRYHGTLGTAIAKVLDLSAACTGNNERLLKRLAIPYQVVHIHGMSHASYYPGAHQISLKLLFSPENGRILGAQAVGQGGT
    DKRIDVLATAIKGRLTIYDLPDLELAYAPPYSSAKDPVNMLGYVAENISNGDVMTKQWHEVDAFMADGGIIIDVRDEAEF
    ISGSIKTAVNIPLSELRQKLALIPQDKKILVT
    CQVGLRGYIAARILSQYGYTVANLDGGYLTFNYANA

    >gi|45442448|ref|NP_993987.1| hypothetical protein YP_2674 [Yersinia pestis biovar Microtus str. 91001]
    MSDRPVTPALRLYGIKNCDTIKKARRWLEEQGIAYQFHDYRADGLSDECLQGFIDTLGWEPLLNTRGTTWRKLPPEQRDA
    ITDAQSAKALMLAQPAIIKRPLLEGPNGEMLLGFKIESYQEFIHNQPATEVQ

    >gi|45442460|ref|NP_993999.1| thioredoxin-dependent thiol peroxidase [Yersinia pestis biovar Microtus str. 91001]
    MMSPLKAGDIAPKFSLPDQDGEQISLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKSAGVEVLGISTDKPEKLS
    RFAEKELLNFTLLSDEHHEVAEQFGVWGEKSFMGKTYNGIHRISFLIDADGKVEHVFDNFKTNNHHDIVMDYLRQNA

    >gi|45442466|ref|NP_994005.1| putative oxidoreductase [Yersinia pestis biovar Microtus str. 91001]
    MGLFAGKPFVYWQIASGLLINSRLAKRKTARKVIMKDVTIYHNPRCSKSRETLALVEQQGITPQVVLYLETPPSVDKLKE
    LLQQLGFSDARQLMRTKEDLYKTLNLDDRGLTQDQLLQAMADNPKLIERPIVVTQGKARIGRPPEQVLEILK

    >gi|45442858|ref|NP_994397.1| thiamine biosynthesis protein ThiF [Yersinia pestis biovar Microtus str. 91001]
    MKNDQTLSDSEFLRYSRQLLLEDIGPEGQRKLKGASVLIVGLGGLGSPAALYLAAAGVGQLLLADDDQLDLTNLQRQILY
    RTADIGQTLSNPTSSVSHNKARLAQRHLQQLNPQIRIVALDTRLTGQVLTDAVANADLVLDCSDNMETRHQVNAACVTAQ
    KPLISGSAVGFSGQLLVIEPPYAQGCYACIYPDKELPQRN
    CRTAGVLGPVVGVIGTLQALEAIKMLAGIPLALSGKLRLF
    DGKQQSWSTLQLTRAAHCPACGGGL

    >gi|45442885|ref|NP_994424.1| dihydrolipoamide dehydrogenase [Yersinia pestis biovar Microtus str. 91001]
    MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEAVHQIEKAPGFGIHPQGKPLI
    NGREVMDRVKRERDRFVGFVLEGVETIPAADKIQGYARFIDDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNEL
    GDRLIINDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRDYAAKTLGDEFYLDPDVKV
    ELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDKLGLENTSLILDERGVPQADRLTMQTNVPHIFIAGDASNQ
    LPLLHEASDQARIAGVNAGGFPEVVPGLRRSPISVVFSDPQIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVMLK
    NKGILRIYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEEGLRTALRDLQSKLKLGADEAER
    CLRCPGE

    >gi|45442886|ref|NP_994425.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis biovar Microtus str. 91001]
    MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGAFTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVND
    TFVMNAWKSDQHAENITFVPDGNGEFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    KYLAPDFKVQESVAVFTKPG
    CPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVPQIFIGGRHIGGSDDLEKY
    LPA

    >gi|45442888|ref|NP_994427.1| soluble pyridine nucleotide transhydrogenase [Yersinia pestis biovar Microtus str. 91001]
    MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIK
    SSFADILNHADRVINQQTRMRQGFYDRNHCHMFSGDASFIDANTVNVRYADGTSDTLQADNIVIATGSRPYRPVNVDFNH
    ERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNEEF
    EQIEGTTDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLENIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLAS
    AAYDQGRIAAQAMIKGEANVHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKILF
    HRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTLEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|45442929|ref|NP_994468.1| thioredoxin 1 [Yersinia pestis biovar Microtus str. 91001]
    MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLNIDDNQGTAPKYGIRGIPTLL
    LFRDGEVVATKVGALSKGQLKAFLDANL

    >gi|45442980|ref|NP_994519.1| zinc/cadmium/mercury/lead-transporting ATPase [Yersinia pestis biovar Microtus str. 91001]
    MHSHSEHQKSVETNSNCGCGHTHDKHQTGCSNLATAANSDAISHDSVSEHSHHDGESCSHTHADEADEESDRLDTTIVSG
    TQRFSWQVKGMD
    CPSCARKIENAISGLDGVEKVKVLFTTEKLVVDARADVRSLVQKAVIATGFSLVNTQTTAGQKNVATE
    SRLREYLPLALLSTLMLISWGLSFFNTELSQTAFTITTIVGLIPFVIKSWKLIRSGTPFAIETLMSVAAIGAVFIGATAE
    AAMVLLLFMVGELLESYAVNRARRGVTALMALVPEEALLLKDGKRTLVPVADLRPGDIIEIPPGGRLPADAELQASFASF
    DESALTGESIPVERQQGEKVAAGCLSVDRAVEMCVVSEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPIIILFS
    ILVILVPPLVFAAPWEPWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGRSQIIAFDKTGTLT
    EGKPKVTDVLPISGISETRLLTLAAAVEAGSHHPLAIAIIQCTQQNQRAQQNQRAQQNTPMLPLAEERRALAGVGIEGVV
    DGLMVRVSAPSKLSPALLTDEWQAQIDQLESSGKTAVVVLEDEKFIGLLALRDTLRTDAKQAIDALKKLGIQGVMLTGDN
    PRAAAAIAGELGIDYRAGLLPADKVQAVMALNALQPTVMVGDGINDAPAMKASSIGVAMGSGTDVALETADTALTHNRLT
    GLAEIILLSRAANANIRQNITIALGLKAIFLVTTLLGLTGLWLAVLADSGATALVTANALRLLRKRDV

    >gi|45443089|ref|NP_994628.1| glutathione reductase [Yersinia pestis biovar Microtus str. 91001]
    MTGYLMETTLMTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKQLGGTCVNVGCVPKKVMWHAAQIAEAIHLYGPDY
    GFDTTVNHFDWKKLIANRTAYIDRIHQSYERGLGNNKVDVIQGFARFVDAHTVEVNGETITADHILIATGGRPSHPDIPG
    AEYGIDSDGFFELDEMPKRVAVVGAGYIAVEIAGVLNGLGTETHLFVRKHAPLRTFDPLIVETLLEVMNTEGPKLHTESV
    PKAVIKNADGSLTLQLENGTEVTVDHLIWAIGREPATDNLNLSVTGVKTNDKGYIEVDKFQNTNVKGIYAVGDNTGVVEL
    TPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLTEPQAREKFGDDQVKVYTSSFTAMYSAVTQHRQPCR
    MKLVCVGAEEKIVGIHGIGFGMDEILQGFAVAMKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|45443322|ref|NP_994861.1| thiol:disulfide interchange protein DsbC [Yersinia pestis biovar Microtus str. 91001]
    MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPIPGISTVMTESGVLYISADGKHLLQGPLYDVSGDQP
    INVTNQALLKKLEALSSEMIVYKAPEEKHVITVFTDIT
    CGYCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSI
    WCMADRNKAFDDAMKNNDISPATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKEMLQMLNAHQASLKAGG