Yersinia enterocolitica 8081 uid57741

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|123440423|ref|YP_001004417.1| periplasmic protein disulfide isomerase I [Yersinia enterocolitica subsp. enterocolitica 8081]
    MKNVWLALVGMVMAFSASAAQFTDGTQYQTLNKPVTGEPQVLEFFSFYCPHCYQFEEVYHVPQAVKKALPEGTKMTRYHV
    EFLGPLGKQLTQAWAVAMALGVEEKITPLMFEGVQKTQTVQTPDDIRNVFIKAGVSGEEFDAALNSFVVKSLVVQQQKAA
    EDLELRGVPAMFVNGKYMIKNDGMDTSSMDTYVKQYADVVKFLLTQK

    >gi|123440478|ref|YP_001004472.1| hypothetical protein YE0078 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MLQEIMQFISQHPVLSLAWVALFVAVIFTSFKTTLSKVKEITRGEATRLINKEDAVVVDIRTRDDYRKGHIASSINLLPS
    DIKNGNLAELEKHKAQPVIVV
    CATGTTSRASAELLNKAGFERVFTLKEGISGWSGENLPLARGK

    >gi|123440479|ref|YP_001004473.1| glutaredoxin 3 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MAKIEIYTKATCPFCHRAKALLNSKGAAFHEIAIDNDPAKREEMIARSGRTTVPQVFIDGQHIGGCDDLHALDARGGLDP
    LL

    >gi|123440484|ref|YP_001004478.1| bifunctional regulatory protein/DNA repair protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MKTTGVYCRPSCSSRQAKVENIEFYADNDAAELAGYRPCKRCRPTQLSQAQQHAEKISQACRLIEQAETPFTLDALAAEL
    NLSTFHFHRLFKSITGLTPKAYASATRSARIRQQLVEKGSVTEAIFEAGYNSNGRFYEQSNQLLGMTPTRYRQGGRDTAL
    RFAVGESSIGAILMAQSELGICAILLGDDPALLVKQLQDKFPQAELIGGDAEFEQWFAQVVGLVEAPQLGLDLPLDIRGT
    AFQQRVWQALREIPAGDTASYADIAAKIGAPKAVRAVAGACAANMLAVAIP
    CHRVIRQDGALSGYRWGIERKKRLLEKEQ
    QEVGTRDQPDPA

    >gi|123440530|ref|YP_001004524.1| dihydrolipoamide dehydrogenase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MKTLNVDVAVIGGGTAGLGAYRAAKLATPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEAVHQIEKAPDFGIHPQGDILI
    NGREVMDRVKRERDRFVGFVLEGVDNIPANDKIQGYAHFIDDNTLQVDDHTRIVAQRIVIATGSRPSWPAAWNELGDRLI
    VNDDVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGGVGPLTDSIVRNYAAKTLGEEFYLNPDVKVEVMQR
    EGDKVFIRYLDDAGLPQEIMVDYVLAATGRRPNVDKLSLENTSLVLDDRGVPPADRLTMQTSVPHIFIAGDASNQLPLLH
    EASDQARIAGVNAGGFPEVIPGLRRSPISVVFSDPQIAMVGSTFRELSQKFSACGCFEIGEVSFENQGRSRVMLKNKGIL
    RVYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTINQMLDMPFYHPVIEEGLRTALRDLQSKLKLGTDEAERCLRCP
    GE

    >gi|123440531|ref|YP_001004525.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MFTSQEGKKVPQVTFHTRQGDQWVDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVND
    TFVMNAWKADQHAENITFIPDGNGEFTKGMDMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    KYLAPDFKVQESVSVFTKPG
    CPFCAKAKQMLQDRGIQYEEIVLGKDATTVSLRAVTGRGTVPQVFIGGRHIGGSDDLENY
    LSA

    >gi|123440533|ref|YP_001004527.1| soluble pyridine nucleotide transhydrogenase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARTIS
    SSFSDILNHADRVINQQTRMRQGFYDRNHCQMFSGDASFIDANTINVRYADGTNDTLRADNIVIATGSRPYRPANVDFTH
    ERIYDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNEEF
    EQIEGTVDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLEKIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLAS
    AAYDQGRIAAQAMIKGEANTHLIEDIPTGIYTIPEISSVGKTEQDLTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKILF
    HRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|123440564|ref|YP_001004558.1| thioredoxin 1 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTITKLNIDDNQGTAPKYGIRGIPTLL
    LFRDGEVVATKVGALSKGQLKEFLDANL

    >gi|123440611|ref|YP_001004605.1| zinc/cadmium/mercury/lead-transporting ATPase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MHSHSEHRHSTETQSHCGCGHDHAKKQTGCSSQPAANISHDSSNSVSEHSHQEGGCCSQSSHTDDGDEESDRLANATPAG
    SQHFSWQVKGMD
    CPSCARKIENAVSNLVGIENVKVLFATEKLVVDARSDIRLQVQQAVIQAGFSLIDTQSPGAGKNTESE
    SRFREYLPIALLTTLMLLSWGISLFSVELSELAFTVTTIVGLIPIVTKAWKLIRSGTPFAIETLMSVAAIGAMFIGATAE
    AAMVLLLFMVGELLESYAANRARRGVTALMALVPEEALLLKEGERRQVSVASLRPGDIIEVSPGGRLPADAELMTPFASF
    DESALTGESVPVERVQGEKVAAGSLSVDRATEMRVISEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPAIMFLS
    ALVILVPPLAFAEPWETWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGRIQTVAFDKTGTLT
    EGKPQVTDILPISGVSETRLLSLAAAVEAGSHHPLAVAIMQRAQQNTPMLPLAEERRALAGIGVEGRVNGLVVRVSAPSK
    ISPELLTAEWLAQFDELESSGKTAVAVLENEKFIGVVALRDTLRTDAKQAIDALKKLGIQGVMLTGDNPRAAAAIAGELG
    IDYRAGLLPADKVQAVMALNATHPTVMVGDGINDAPAMKAASIGIAMGSGTDVALETADAALTHNRLTGLAEIILLSRAA
    NANIRQNITIALGLKGIFLVTTLLGLTGLWLAVLADSGATALVTANALRLLRKRDI

    >gi|123440681|ref|YP_001004674.1| thiamine biosynthesis protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MINKHELSDSEFLRYSRQLLLEDIGPEGQLKLKSACVLIIGLGGLGSPAALYLAAAGIGKLLLADDDQLDLSNLQRQILY
    RTTDINQTSASNQTKVRLAQRHLQNLNPLVEIVSFDIRLTDAALADAVANADLVLDCSDNMTTRHQVNAACITAQKPLIS
    GSAVGFSGQLLVIEPPYSQGCYACLYPDKELPQRN
    CRTAGVLGPVVGVIGTLQALEAIKILAGLPSALSGKLRLFDGKQQ
    SWSTLQLTRAKYCPACGGSQ

    >gi|123440732|ref|YP_001004724.1| thiol:disulfide interchange protein precursor [Yersinia enterocolitica subsp. enterocolitica 8081]
    MAQRFITLILLLCSILLAPHSAQASLFGDNSSFGQKSSQSRFIPVDQAFAFDFRQQGDQLALSWQIHPDYYLYRQQIKIV
    PNNATFGAFTLPEGIAHRDEFYGEVAIFKQQLTLKIPITQAGERASVSVTYQGCAEAGFCYPPETRVVPLSAITAGSSAV
    TAPPIAAPATPAPAELPFSPLWALLIGIGIAFTPCVLPMYPLISAIILGREKPHSQRRILLLAIVYVQGMALTYTLLGLV
    VAAAGLQFQAALQHPYVLIGLSALFVLLALSMFGLYSLQLPSSLQTRLVQWSSSQRGGSLAGVFAMGALAGLICSPCTTA
    PLSAILLYIAQSGNMLAGGGTLYLYALGMGIPLVIVTLFGNKLLPRSGPWMQYVKEAFGFVILALPVFLLERVLGDVWGL
    RLWSLLAIAFFGWAFILSLKAHSGWARAFQLLLLAALLIAARPLQDWAFGSPTQQSEIKHLAFKQVADLPQLQAALAQAK
    GKPVMLDLYADW
    CVACKEFEKYTFSDEQVQRQLADTVLLQADVTANSAEHAALLKELNVLGLPTILFFDAPGNEIPAARV
    TGFMNASGFLQHLQNLPR

    >gi|123440785|ref|YP_001004777.1| methionine sulfoxide reductase A [Yersinia enterocolitica subsp. enterocolitica 8081]
    MQNFDKTAVIDAANALPGRLTPMPVATLHVVNGHSMTHVPEGMEVAIFAMGCFWGVERLFWQQPGVYSTAAGYSGGYTPN
    PTYHEVCSGRTAHAEVVRVVFDPAIISYKQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQETQAQESQALFQQA
    MTKAGDSRAITSEIAAALPFYYAEDDHQQYLYKNPQGYCGLGGIGVCMPPNL

    >gi|123441058|ref|YP_001005047.1| dihydrolipoamide dehydrogenase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETILVERYATLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKVRVWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGANTLVVEGENGPTTITFDNAIIAAGSRPIQLPFIPHED
    PRVWDSTDALALKTVPERLLVMGGGIIGLEMGTVYHALGSKIDVVEMADQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDERGFIHVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVISGMKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKL
    IFDKETHRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIYEGSITDLPNPKAKKK

    >gi|123441091|ref|YP_001005080.1| iron-sulfur cluster insertion protein ErpA [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSDETVLPLQFTEAAAKKVKLLISDEENPNLKLRVYITGGGCSGFQYGFTFDDQINDGDMTIEKQGVELVVDPMSLQYLV
    GGAVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|123441142|ref|YP_001005130.1| putative thiol:disulfide interchange protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MVILISSLITTAYFHYFVLNQDAPESLFSVSSSDIENSPIKDDNSIIEIFSYGCHYCAINEDNVSQLENRMPEGTRFIRL
    HISSDKTTGLGRFAPVFATLSVMGIEPQHRQSAYKAVLDDNSDLSDNRQLETWLKANDIDVAKYQQVSQSAEVKALISYM
    TAVTAHYKIDATPTFIVGKKWIALQDREFPAFSDHLLSLLEHDKALEK

    >gi|123441280|ref|YP_001005267.1| putative glutaredoxin [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSIIIYSKPDCVQCNATYRALDKQGIAYQVVDLTEDPQALNRVKSLGYQQVPVIVAGDEHWSGFRPDKINALAQAVGA

    >gi|123441281|ref|YP_001005268.1| hypothetical protein YE0930 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MVEQRLYFSKLSPATYEALVSASMSLDKSSLPKMLIELIFMRVSQINGCAFCLDMHGKFLRNHGFDNAKMDVIAGWKLSN
    LFSEAERAALDWAEAVTHITTSGTPDSTFNALKAHFTDTQISDLTFAISIMNAFNRLAVSLRQ

    >gi|123441292|ref|YP_001005279.1| putative rhodanese-like protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSSLVSQIPPASPERALQHFSQRLAFETDCSDVYSSQQQGTVDFVLVDVRSEAAFASAHVPRAINIPHRLMTATLHSHYP
    METLFVIY
    CAGPHCNGVHRAAINLSQLGYAVKEMIGGVIGWRDEGLPLVGSANENTVVVSCGCSI

    >gi|123441404|ref|YP_001005391.1| iron-sulfur cluster assembly protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSISISDSAAQRVSAFLNNRGKGLGLRLGVRTSGCSGMAYILEFVDEMNDDDIVFEDKGVKVIIDGKSMVYLDGTELDFV
    KEGLNEGFKFNNPNVSSECGCGESFNV

    >gi|123441473|ref|YP_001005459.1| putative arsenate reductase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MKDVTIYHNPRCSKSRETLALVEQQGIKPQVVLYLDSPPSVATLKELLQQLGFSDARQLMRTKEELYKALNLADKALTQE
    QLLQAMSDNPKLIERPIVVYHGKARIGRPPEQVLEIL

    >gi|123441477|ref|YP_001005463.1| thioredoxin-dependent thiol peroxidase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSPLKAGDIAPKFSLPDQDGEQISLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVEVLGISTDKPEKLSR
    FAEKELLNFTLLSDENHEVAEQFGVWGEKSFMGKTYDGIHRISFLIGTDGKVEHVFDNFKTTNHHEIVMDYLRQSA

    >gi|123441489|ref|YP_001005475.1| hypothetical protein YE1148 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSDNPATPLLCLYGIKNCDTIKKARRWLEEQNIAYQFHDYRVDGLSDEHLQGFIDKLGWEPLLNTRGTTWRKLPPAQRDA
    ITDAQSAKLLMLEQPAIIKRPLLEAANGELLLGFKIEVYQQFIQQHLQKVTHNQNAIEVQ

    >gi|123441605|ref|YP_001005590.1| thiol:disulfide interchange protein DsbE [Yersinia enterocolitica subsp. enterocolitica 8081]
    MKSQSSFNKLMFIPLVLFLLLVLAFLVQLTRNANGDDPTMLESALIGKPVPAFKLESLEQPGKTFDQAVLHDGKPMLLNV
    WATW
    CPTCRAEHEYLNKLAAQGIRVVGLNYKDDRAKAVQWLNSLGNPYALSLYDGDGMLGLDLGVYGAPETFLIDGQGII
    RYRHAGDLNDRVWQQEILPLYKKYQGGA

    >gi|123441636|ref|YP_001005621.1| putative metal resistance protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MFNLSKAALFCLLLLWMPTLWAADSGWLVSGQNDHAKVRVRAEPSAGNETRMLLSVQLEKGWKTYWRSPGEGGIAPAITW
    SPPLETVKWYWPVPQRFDVSGISTQGYHEQAVLPIVISGKVPKTLSGTLTLSTCSNVCILTDYPFSLDMSAAVSAEKQQQ
    FEHDFAQAMGQVPIANALTQQIQAGFSQGEVQILALRDDGWQQPELFFDTLEDVDLGNPVVTVQGNQLSVRVPATDGWGE
    GVGDLCGKPLTLVIADGGLAQEATVTIGPALTLPQSASSFWSWILMALAGGLILNLMPCVLPVLAMKLGSILQTEHQTRR
    QVRWQFLASSAGIITSFWLLALLMTALRLGNHALGWGIQFQNPWFIGFMVLVTALFTANLFGLFEIQLSSSLNTRIAAPR
    IEKPGARGMAGHFGQGALATLLATPCSAPFLGTAVAFALAAPLPALWGIFTALGVGMSLPWLAVAAWPKLALCLPRPGRW
    MNHLRIAMGVLMLASSLWLLSLMVSHIGLQTVIIIAAIAVLALLLAIGRRYGARIAAIVSLIAVLIVGGLLLVGSLTADL
    WRKPLHDDIRWQPLTETAIKQALAEHKRVFVDVTADW
    CVTCKVNKIHVLMRDDVQQALQAPDVVALRGDWTRPSADITAF
    LRERGSVAIPFNQIYGPQQPQGVVLSPLLDRDVLLKVLADAKGNEK

    >gi|123441637|ref|YP_001005622.1| putative metal resistance protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MRMLTVLLFVMFSTPLWAAAPFTPEQEVRIKELIRETLISNPDILEQSVNAWQQQANEAQGQQLSQFIAANKQALYQDPG
    SPRFGATTPQLTLVSFTDYN
    CPFCKTFDPLLEKLVKEYPQVAVVIKPLPFKGESSVTSARLALTLWQQHPEQWMAFHQRL
    MAKKGFHDAGSIAAAQKKTGVTPAALSEQSLNVLRSNLKLADQLGIQGTPATLIGDQMVPGAISYQELEEIVKQQLAQAG
    K

    >gi|123441638|ref|YP_001005623.1| putative metal resistance protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MNRLKRWGKELMVLLLLVVVVSVAMDWLRRPQAPANWPDTPRQTLAGKAVSLSEMSQEKPLLIYFWATWCGVCKFTTPSV
    NQLVQEGENALTVALRSGDSAQVETWLRKKGYQLPVINDPQGELSAQWQINVTPTVVILYQGKMVQHTSGWTSYWGMKLR
    LWLASF

    >gi|123441802|ref|YP_001005786.1| glutaredoxin 1 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MFAVIFGRPGCPYCVRAKELAEKLETERDDFKFRYIDIHAEGITKADLEKTVGKPVETVPQIFIDEKHIGGCTDFEAYAK
    ENLSLFQ

    >gi|123441835|ref|YP_001008375.1| thioredoxin reductase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSTAKHSKLIILGSGPAGYTAAVYAARANLNPVLITGMEKGGQLTTTTDVENWPGDPEGLTGPALMERMHAHAEKFQTEI
    LFDHIHKVDLQNRPFRLFGDSAEYTCDALIIATGASARYLGMESEEAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLANIAAEVHLIHRRDSFRSEKILIDRLMEKVKNGNIVLHTDRTLDEVLGDDMGVTGVRLKSTKNNETEEETEELAV
    AGVFIAIGHSPNTAIFDGQLALENGYIKVQSGIQGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
    VNDK

    >gi|123441922|ref|YP_001005905.1| tetrathionate reductase subunit B [Yersinia enterocolitica subsp. enterocolitica 8081]
    MDQGKRAFLQRLGGLTAGAALVPLADAGWQMEPVRKQGDIKRRYAMLIDLRRCIGCQACTVSCAIENQLPQGQFRTTVNQ
    YQIALSGAESVTNVLLPRLCNHCDNPPCVPVCPVQATYQRQDGIVVIDNTRCVGCAYCVQACPYEARFINHSTQTADKCT
    FCVHRLDAGLLPACVESCVGGARIIGDLRDGNSTLRKMLLEHAADIKVLKPEQGTHPQVFYLGLNEVFTQSLQGQPALWQ
    EVHA

    >gi|123441925|ref|YP_001005908.1| hypothetical protein YE1619 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MPVLHNRISNEELKARMLAETEPRTTVSFYKYFILEDAKAFRDNLYSQFVKLGVFGRVYVAKEGINAQISVPANRYDEFK
    VVLFAAHPALDQVRLNVAHEDDGKSFWVLRMKVRERIVADGIDDDSFDPSNVGHYLKADQVNQMIDDPDTLFVDMRNHYE
    YEVGHFENAIEVPSDTFREQLPMAVDMLQHDKEKNIVMY
    CTGGIRCEKASAYMLHNGFKNVFHVEGGIIEYARKAKEQGL
    PLKFIGKNFVFDERMGERISEDVIAHCHQCGTPSDTHTNCKNDGCHLLFIQCPACAAKFEGCCSPICQEELKLPQEEQRA
    RRAGRENGIKIFNKSKGLLQTTMHIPMPDK

    >gi|123442260|ref|YP_001006241.1| electron transport complex RsxE subunit [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSEARDLLAQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNTAVSALRRWVPNEIRIPIYVMIIASVV
    STVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVIGRAEAYAARNPVGLSALDGLAMGLGATCALFVLGSLREILGNGTLFDG
    ADMLLGDWAKVLRIEVLHLDSPFLLAMLPPGAFIGLGLLLAGKYVIDEKMKARKARALATAPQLQDGVAEKAL

    >gi|123442266|ref|YP_001006247.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia enterocolitica subsp. enterocolitica 8081]
    MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASVCAWMVNSFILLPLGLVYLRTLAFILV
    IAVVVQFTELVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNINQSHNFMQSAVYGFSAAAGFSLVMVLFAAIRERLAV
    ADVPAPFRGSSIALITAGLMSLAFMGFTGLVKF

    >gi|123442339|ref|YP_001006318.1| putative methylated-DNA--protein-cysteine methyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081]
    METFLIDRMATPQGELLLIADEEHRLRAIDWTDHYERLMKLLRNHYGANTFSLVEQRNPGGLSDSMQRYFAGELNIIDNL
    PVKTAGTDFQRQVWQQLRKIPCGETITYGELAKRINRPTASRAVGMANGLNPISIVVP
    CHRVIGQQGALTGYAGGVERKR
    WLLMHEGYLLAR

    >gi|123442374|ref|YP_001006353.1| thiol peroxidase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MTQTVHFQGNPVTVAGQLPQPGDKAKDFTLVAKDLSDVALSSFVGKRKVLNIFPSIDTGVCAASVRKFNQLAGELENTVV
    LCISSDLPFAQSRFCGAEGLSNVTTLSILRGADFKQAYGVAITEGPLAGLTARAVVILDGQDNVIYSELVNEITTEPDYD
    AALAALK

    >gi|123442392|ref|YP_001006371.1| hypothetical protein YE2131 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MVQFRRQDNAHWYHETQRSGGALATQIVDESDTANSGNIGNTYQIGAPLEQGIFLLGLANDIPLALTHSLQHYAAILSAS
    DAMYLALFPAVVALNHENTFSLYDRLSSALTVAQVTGIQRLCSHYAALLTPLSSPDASRESNMRLTQITQYARQLASQPT
    LIDRHALQQLAEVGLTDADIIVLSQIIGFVGFQARVVAGFSAQAGYPTVMLPGFPRMEDAPSALLLESEPQWQGWLPSLA
    QSDSVTAEDTSVASEVTLNELLSHHQESLSAYSAITAQLDNPDRVPADWQEWVSLVSARINGSLY
    CQAHHQHNLQQLTKD
    SALLAALQAGVDQALAAQATEQISHQLIAVTAELTRAPERFSQQHISPLRAMGLGDKQLLGIIFSAASAGWTNRLRHTLG
    QTV

    >gi|123442416|ref|YP_001006395.1| hypothetical protein YE2155 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MTTIDKIQRQIAENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELV
    GGCDILMEMYQRGELQQLLKETADKYRTEKPAAE

    >gi|123442433|ref|YP_001006412.1| iron-sulfur cluster assembly scaffold protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MQQESVGTFSLDDNVWQGVTITDSAAAQITRLMQQDPEIKGLQLGVKQSGCAGFAYVMDMAKEPASDALVFEHGSARLYV
    PLKAMPFIDGTVVDYVREGLNQIFKFNNPKAQHACGCGESFGV

    >gi|123442444|ref|YP_001006423.1| hypothetical protein YE2183 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSSLNITAANEGSGAELNNSPQFSNSYGQQLSGFYTHLQPTPLKGARLLYHSEPLARELELDTSWFSDPKAAVWAGEMLL
    PGMEPLAQVYSGHQFGQWAGQLGDGRGILLGEQKLSDGRHMDWHLKGAGLTPYSRMGDGRAVLRSVVREFLASEALHHLG
    VPTSRALTIVTSDHPVYREQAERGAMLLRVAESHVRFGHFEHFYYRQQPAQVKQLADYVIARHWPQWVGLEECYLLWFTD
    VVKRTARLMAHWQTIGFAHGVMNTDNMSILGITMDYGPFGFLDDYVPDYICNHSDHQGRYAFDNQPAVALWNLHRLGQAL
    SGLLSTAQLQQALEAYEPELMAAYGQQMRAKLGFSDSDSQDNDLLTGLLSLMIKEGRDYTRTFRLLSEVETHSALSPLRD
    DFIDRAAFDSWYSRYRARLQQEQIDDAQRQQAMSAVNPKYILRNYLAQLAIDQAEKDDIQPLQRLHQALQQPFAEQPELN
    DLAALPPDWGKHLEIS
    CSS

    >gi|123442455|ref|YP_001006434.1| putative glutathione peroxidase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSHSIYSIPVKTIESQSVNLEKYKGSVLLVVNVASQCGLTKQYEGLENLYKTYQQQGFEVLGFPSNEFAGQEPGSDEEIQ
    AFCRGTFGVDFPMFSKIEVNGPQRHPLYQHLIAAKPVAVKPESSEFYQRLASKGREPKHAGDILWNFEKFLIGRDGTVLE
    RFAPDMTPEDPILVNAITRALAAH

    >gi|123442509|ref|YP_001006486.1| selenophosphate synthetase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MTSPAIRLTQYSHGAGCGCKISPKVLDKILHSEQQKFLDPRLLVGNETRDDAAVYDIGNGVGIISTTDFFMPIVDDPFDF
    GRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEVAQQVIEGGRYVCQQAGISLAGGHSIDAPEPIFGLAVTGIVSTE
    QVKKNSAAKAGCKLFLTKPLGIGILTTAEKKSQLRPEHQGVATETMCQLNKSGADFAHIPGVTAMTDVTGFGLLGHLSEI
    CQGSGVQATLHFSSIPRLPAVAEYIAAGCVPGGTGRNFDSYGHLIGKMSDLQKSLLCDPQTSGGLLLAVLPDAEAQVQEI
    AAQHGMTLSAIGELNVVDNDRALIEITE

    >gi|123442515|ref|YP_001006492.1| methionine sulfoxide reductase B [Yersinia enterocolitica subsp. enterocolitica 8081]
    MAKELNPTENIEKLTDIQRHVTQLRGTEAPFSGKLLHNKREGVYQCLCCHQPLFISESKFDSGCGWPSFYQPLDAESIRY
    IDDYSHNMHRVEIRCGHCDAHLGHVFSDGPQPTGERY
    CVNSASLNFVDDQNGEQIPG

    >gi|123442536|ref|YP_001006513.1| disulfide bond formation protein B [Yersinia enterocolitica subsp. enterocolitica 8081]
    MLQFLNRCSKGRGAWLLMALTALVLELVALYFQHVMLLQPCVMCIYERAALFGILGASLLGAIAPKSPLRYLAIFIWIYS
    AWKGVQLAWTHTMLQLHPSPFTT
    CDFFVSFPSWLPLDKWFPAVFVASGDCAVKQWEFLSLEMPQWLVGIFAAYLFIAILV
    LISQFVKPKRRDLFSR

    >gi|123442721|ref|YP_001006698.1| putative thioredoxin [Yersinia enterocolitica subsp. enterocolitica 8081]
    MLSACKQEEVAVGEVAPQLAAYDLQGKPVALEQWKGKQVYLNFWSASCGGCLAEMATLDKLSQQYQQDIVVVAINTDPEQ
    VDIAPVLAQRNISYPVIRDQLGITQERYQVIGTPTSFMIDRNGKVTELHQGARDEKALTTLFQQWAAGA

    >gi|123443044|ref|YP_001007018.1| molybdopterin biosynthesis protein MoeB [Yersinia enterocolitica subsp. enterocolitica 8081]
    MPELSDAQALRYNRQIVLRGFDFDGQEKLNAAKVLIVGLGGLGCAAAQYLTVAGVGHLTLLDFDKVSLSNLQRQVLHRDN
    RIGMSKVASAALTLSEMNPSLIIKTIDAQLDDEQLAIAIAEHQLVLDCTDNVASREQLNRLCHAQRKPLVSGAAIRMEGQ
    VSVFTYQEDQPCYRCLSRLFSDNALT
    CVEAGVMAPLVGIIGNLQAMEAIKLLTQYGQVISGRIVMYDAMTAEFRSLKLAK
    DANCEVCGKDELAKVADQPVL

    >gi|123443083|ref|YP_001007057.1| putative sulfurtransferase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MNSSFLVTPQWLAEHIDDTNIVILDARMSPPGLIPKRNIQAEFEQGHIPGAVYFDIDAIADSSTDLPHMLPSPQVFSEMV
    GQLGVSEQHTLVIYDDGNLFSAPRVWWTLRIFGAKNVYILAGGFSGWQQAGLALESGPTFPTPQTFNATFNDAAVKNVHE
    VLAALGNNEIQILDARPAARFKALEPEPRPGLRLGRIPGSINVPWGSMVENGNLKSPQALEAIFAAQGVDLTKPIITS
    CG
    SGVTAAVVALGLAAVNAPSIALYDGSWAEWGASDSLPIDSTKLS

    >gi|123443266|ref|YP_001007240.1| putative thioredoxin [Yersinia enterocolitica subsp. enterocolitica 8081]
    MLTPTTIDITEANLHQTLEQSMTVPVLFYFWSERSQHCLQLTPVLDKLAAEYAGQFILARVDCDAQQMVASQFGLRSIPA
    VYLFKDGQPVDGFQGPQPEEVIRELLQRVLPKPEELKAAEAAQLMSEGKVQEALPLLKDAWQLMQQSHNPQTSDTALQLA
    EAQIQLNRSEDAESVLATIPLQDRDSRYQGLIAQIELLKQAADTPEIQQLQQQVAEQPDNVELAVQLALQLHQVGRNEEA
    LELLLGHLKQDLAAANGTARKTLMDILAALGTGDALAAKYRRQLYALLY

    >gi|123443270|ref|YP_001007244.1| copper exporting ATPase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MLQTTVLALHGLSCMNCAKRVKTALESREDVHHAEVNVHYAKVTGEAETTTLIDTVKQAGYQAEEAQTPDIELQLSGLSC
    GHCTESTRKALEAVPGVIAADVSLDNAKVYGKVEAQTLIDAVEQAGYHATLPGAQSPKTEPLTDSAPSSPEYLAAASSTI
    PAATTDIKNTQPSQPVAEPADNDSVQLLLTGMS
    CASCVSKVQNALQSVDGVEVARVNLAERSALVTGHPSNEALIAAVKN
    AGYGAEIIEDETERRERQQQMSQASMKRFQWQAALGLLLGIPLMGWGLFGGSMTLTPETQTPWLIVGIITLLVMIFAGGH
    FYRNAWVSLKNGSATMDTLVALGTGAAWIYSITVNIWPDVFPMEARHLYYEASAMIIGLINLGHAMEQRARQRSSNALER
    LLDLAPPTARLVTDEGEKLIPLADVQLGMTLRLTTGDRVPVDGEIVQGEVWMDEAMLTGEPIPQQKSTGDVVHTGTQVQD
    GTVLFRANAIGSQTTLARIIKLVRQAQSSKPEIGKLADRISAVFVPTVVAIAVIAGLIWYFFGPQPQLIYTLVVATTVLI
    IACPCALGLATPMSIISGVGRAAEFGVLVRDADALQQASNLDTLVFDKTGTLTEGHPQVVAIHTFNGVSEQQALEWAAAL
    ETGSNHPLARAILQRAEGLTLATVNQFRTLRGLGVSGEVDGVALLLGNNRLLEEQQIDTSELQSLIQQQAESGTTPVILT
    AQGKPAALLSIRDPLRSDSISALQRLHQRGYNLVMLTGDNPITANAIAKEAGIDQVIAGVLPDGKAEAIKQLQAAGHKVA
    MIGDGINDAPALAQADVGIAMGGGSDIAIETAAITLMRHSLHGVADAVELSKATLRNMKQNLLGAFFYNALGIPIAAGIL
    FPFTGTLLSPVVAGAAMALSSITVVSNANRLLRFKPKQ

    >gi|123443307|ref|YP_001007281.1| hypothetical protein YE3098 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MRLSIALKEQQGDLDLRLFLMSDAVIAGLQGQQPAEGYNLRQMLEILTAQNVPVKLCKTCTDARGITGLALVDGVEIGTL
    VELAQWTLAAEKVLTF

    >gi|123443378|ref|YP_001007352.1| putative alkyl hydroperoxide reductase subunit c [Yersinia enterocolitica subsp. enterocolitica 8081]
    MVLVTRQAPDFTAAAVLGSGEIVENFNLKKHLNGRPAVLFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEF
    VHNAWRKTPVDKGGIGEVKYPMVADIKREIQKAYGIEHPDAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKAGMGASPDGVAKYLSENASKL

    >gi|123443419|ref|YP_001007392.1| Na(+)-translocating NADH-quinone reductase subunit E [Yersinia enterocolitica subsp. enterocolitica 8081]
    MEHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNF
    ITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFPESIVYGFGSGIGWMLAIVALAGI
    REKMKYANVPAGLQGLGITFITTGLMALGFMSFSGVNL

    >gi|123443420|ref|YP_001007393.1| Na(+)-translocating NADH-quinone reductase subunit D [Yersinia enterocolitica subsp. enterocolitica 8081]
    MADSKEIKRVLLGPLFDNNPIALQILGVCSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHIPNSVRIIVQMVIIA
    SLVIVVDQILRAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVVLVLVGFVRELIGSGKL
    FGVTVLETVQNGGWYQPNGLFLLAPSAFFIIGLLIWGLRTLKPAQIEKE

    >gi|123443446|ref|YP_001007419.1| thioredoxin 2 [Yersinia enterocolitica subsp. enterocolitica 8081]
    MNTVCTACMATNRLPEARIDDGAKCGRCGHSLFDGSIINATAETLDKLLQDDLPVVIDFWAPWCGPCRSFAPIFTEVAAE
    RAGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMVDMLSGALPKAAFDNWLNEQLSVEPAAR

    >gi|123443563|ref|YP_001007536.1| arsenate reductase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MNNITLYHNPACGTSRNTLEMIRNSGAEPTIIYYLETPPSRDVLMKLIADMGISARALLRKNVEPYETLGLAKDCFTDNQ
    LIDFMLQYPILINRPIVVTSLGTRLCRPSEVVLEILSDDQKGAFTKEDGEKVIDDAGKRLK

    >gi|123443575|ref|YP_001007548.1| thiol:disulfide interchange protein DsbC [Yersinia enterocolitica subsp. enterocolitica 8081]
    MKKSLLLLPIVIAALTGLAHADDAAIQQTLKKLDMQQADIQPSPIPGLSTVMTDSGVLYISADGKHLLQGPMYDVSGNQP
    VNVTNQILMKKLEALSNEMIVYKAPQEKHVVTVFTDIT
    CGYCHKLHEQMSDYNALGITVRYLAFPRQGLSSQAEKDMRSI
    WCMADRNKAFDDAMKGVDISPATCKTDISEHYKLGVQFGIQGTPAIVLQNGTIVPGYLEPKEMLQMLNKHQASSKAAG

    >gi|123443616|ref|YP_001007588.1| hypothetical protein YE3422A [Yersinia enterocolitica subsp. enterocolitica 8081]
    MTIDWANFTPFSALAGGALLGIAVTILWLCNGRIAGISGILGGLLPPKAGNISWRVAFVLGLIMAPIIYSIFTDLPVIQI
    DADLPVLIVAGLLVGIGTRYGAG
    CTSGHGVCGLARFSPRSLLATLSFMLTGFATVWLVRHLFT

    >gi|123443663|ref|YP_001007634.1| arsenate reductase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSNITIYHNPACGTSRNTLEMIRNSGTEPTVILYLETPPSRDELVKLIADMGIRVRSLLRKNVEPYEELGLAEDKFTDDQ
    LIYFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILTDAQKGAFAKEDGEKVVDETGKRLK

    >gi|229576792|ref|YP_001008135.2| thiosulfate sulfurtransferase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MEQFETISIEQAYNRLKEHQAVLVDIRDPQSFEAGHAPEAFHLTNSSLHTFMQQTDFEQPVMVMCYHGNSSKGAAQYLLQ
    QGFEAVYSIDGGFEAWARSYPQDVVQAS

    >gi|123444230|ref|YP_001008198.1| glutathione reductase [Yersinia enterocolitica subsp. enterocolitica 8081]
    MTKHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKELGGTCVNVGCVPKKVMWHAAQIAEAIKLYGPDYGFDTTVNHFD
    WKTLIANRTAYIDRIHQSYDRGLSNNKVDVIKGFARFVDAHTVEVNGEKITADHILIATGGRPSHPDIPGAEYGIDSDGF
    FELDEMPKRVAVVGAGYIAVEIAGVLNGLGTETHLFVRKHAPLRTFDPLIVETLLEVMNTEGPKLHTEAVPKAVIKNADG
    SLTLQLENGTEVTVDHLIWAIGREPATDNLNLAASGVKTNEKGYIEVDKFQNTNVKGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLTEPQAREKFGDEQVKVYKSSFTAMYSAVTQHRQPCRMKLVCAGPEE
    KIVGIHGIGFGMDEILQGFAVAVKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|123444264|ref|YP_001008232.1| putative osmotic/stress related protein [Yersinia enterocolitica subsp. enterocolitica 8081]
    MSIEKVVYRAKAKATGGRDGRATSSDGVLDVKLGVPKEMGGAGGAVTNPEQLFAAGYSACFLGALKFVASKEKVKISDDA
    SIEGTVGIGAIPTGFGIEVQLDISLPGIERSVAEDLVKKAHVV
    CPYSNATRGNIDVTLNIK