Xylella fastidiosa Temecula1 uid57869

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|28198024|ref|NP_778338.1| hypothetical protein PD0087 [Xylella fastidiosa Temecula1]
    MTTLYGLKNCDTCKKANKWLDRFSIAYVFVDYCENIPSPETLVTWSKEAGSFDALINKSSTTWRQLPSNRKTPCSEAEWK
    LLLREYPHLIRRPVVLTSDGIFSQGFSDNGFKKRFGID

    >gi|28198395|ref|NP_778709.1| thioredoxin [Xylella fastidiosa Temecula1]
    MQIITATSPDEFNAALKAHSRLLVDFYKEHCPGCRMLDMALNKFAATDAAAGVVVLKIRLETIGEDFFRDLGLRQTPTLG
    VFKNGLEVSRLLGFQSLAQIEAAVQTYL

    >gi|28198403|ref|NP_778717.1| glutathione S-transferase [Xylella fastidiosa Temecula1]
    MKLYIMPGACSLADHILLRWSGSSFDLQFLDHQSMKAPEYLALNPAGAVPTLQVGDWVLTQSVAILNYITDIAPAERGLS
    GDGSLKARAEINRWIAFSNSDVHPMYRALFGGTTYLQDPQMIALSQDNARQKLRVLYQRADAHLKHHNWLANGQRSGADA
    YLYVTLRWAKKVGVDLSSLDALSAFFERMEADPGVQAALQAEGLI

    >gi|28198559|ref|NP_778873.1| disulfide isomerase [Xylella fastidiosa Temecula1]
    MYRLIAALLLGIVTLTACAQPSQPSSNKTSTTPTNTTPANVQQRVTAALNTLDPDFKPDYIGAAPFPGFREVVVSGQILY
    VSDNGRYLIQAQPYDIQNKKFAVSEGLLSYRRTQLATVPQSQRIVFAPKNPQYTISVFTDIE
    CGYCRKLHSEIAELNKQG
    IAVEYLAFPRMGLGSEDYKDMVSVWCAADRKQALTEAKAGKKIQNKNCNNPVALEYSLGQRIGVNGTPAIFAPDGTQLGG
    YLPPEKLRALLDKLAAATAKGG

    >gi|28198566|ref|NP_778880.1| thiol:disulfide interchange protein [Xylella fastidiosa Temecula1]
    MSLFGRLLSLLLAFVPLSICAAVNHLPVVGEDYVEIPDGRPFAPLAGKIEVVEIFGYTCPHCAHFDSKLQAWGARQAKDV
    RFTLVPAVFGGVWDPFARAYLAADVLGVAKRSHAAMFEAIHEKGSVPIQNVGPDELAVFYAGYGVQPDRFVATFNGPEVE
    KRFQAARAYALKVRPVGTPAIVVDGRYMVTGHDFDDTLRITDYLVSRERAASHGR

    >gi|28198567|ref|NP_778881.1| thiol:disulfide interchange protein [Xylella fastidiosa Temecula1]
    MKNRFAMMLMALLPVLVACQAKDGSADTVQSAVPAPSAPPSSSTATTTPTTPPPESARPVEASRVPSGPKPVAGTDYVVI
    QDGQQFQPVSGKVEVVEVFGYI
    CPACFQFQPQIALWKAGLASDVNFVYVPAVFGGPWDDYARAFYAAETLNLQEKTHQQL
    YKAIHVDRTLKGERGRDTVQDIANFYAKFGVNPEQFVNTMSSFGISAKVNRAKQFAKHSQVTGTPSLIINGKYLVKGRTY
    DDMLRIADHLIEGERKVLGK

    >gi|28198577|ref|NP_778891.1| thioredoxin reductase [Xylella fastidiosa Temecula1]
    MSDYPASAKHSRLLILGSGPAGWTAAVYAARANLQPVLITGLQQGGQLMTTTEVDNWPGDAHGLMGPDLMERMQAHAERF
    ETEVIFDQIYKADLSTRPFTLFGDSGIYTCDGLIIATGANAKYLGIPSEEAFKGRGVSA
    CATCDGFFYRDQDVAVIGGGN
    TAVEEALYLSNIARKVYLIHRRDKLRAEKIMQNKLFSKAATGKIELIWNNAVEEVLGNDAGVTGVRIRSTQDSSTRDIDV
    QGLFVAIGHHPNTDLFAGQLAMNNGYLQIHSGTAGNVTQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDKG
    N

    >gi|28198612|ref|NP_778926.1| hypothetical protein PD0706 [Xylella fastidiosa Temecula1]
    MNDETDVMWMTRMNAILLGSVLRIFIITFMILIAACQVSLPDSVMPRPVDTTMHKLSVADPTQPVTSGNTPTAADIAAVA
    ALNAEFDPGRDPVADLATAKVEAKRGGKQIILSIGSKR
    CSWCRVMDEFINGDAEIRSFRDAHFIWMKVNVSDENKNEVFL
    ARFPKVKNYPHLFVLDADAKLLSSRFTADFEKGHSYDRRRFFAFLRQSVPSKN

    >gi|28198651|ref|NP_778965.1| subunit C of alkyl hydroperoxide reductase [Xylella fastidiosa Temecula1]
    MSVLNTEILSFKATAYKNGQFVEVSEAVFKGKWAVFVFYPADFTFVCPTELEDLADHYEEFQKYGVEIYSVSTDTHFSHK
    AWHDISPAIGKIKYAMIGDPTHEISRNFNVLRPSGLADRGTFIIDPQGVIQSVEITAEGIGRDAKELLRKVKAAIYVANH
    PGEVCPAKWEEGGKTLAPSLDLVGKI

    >gi|28198652|ref|NP_778966.1| subunit F of alkyl hydroperoxide reductase [Xylella fastidiosa Temecula1]
    MFDESLKAQLKAYLDRVIRSIHIHASVDESHKSREMLDLLENIVLLSGKKVVLEVHRDDDKRKPSFGLSTPGESISIRFA
    GLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHYRFETYFSVS
    CQSCPDVVQALNMAAVLNPQIEHVAIDGALF
    QDEVEARQIMSVPTVYLNGELFGQGRMTLEQIVAKLDSGAAKRTAESIQAKAVFDVLVVGAGPAGVAAAVYAARKGVRTG
    LVAERFGGQVLDTMTIENFISVPETDGPRMAAALEQHVRQYEVDIMNLQRVETLVPAGENGFIEVRLASGASLSSRTVIL
    STGARWRQMNVPGEDEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIASYVTLLEFDTKLRADEVLQRKL
    RSMSNVEVIMGAQTTEVRGDGKKVTGLVYVDRSTGGSFILALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDERGHTSL
    PGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRNVVEITGIAQAQAA

    >gi|28198664|ref|NP_778978.1| dihydrolipoamide dehydrogenase [Xylella fastidiosa Temecula1]
    MSEHYDVVVIGAGPAGYHAAIRAAQLGLKVACVDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQYWNMGHLFNEHGIS
    FKDAKMDIATMIARKDKIVKQFTGGIAMLFKANKITPYYGFAQLQPGNVVKVKQHEGKNIELKGANVILASGSDSVELPF
    ATFDGETIVDNIGALDFTKVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEAMPNFLAAVDADVAKTAAKEFKQQGLDIK
    LGAKVSRTEISSKNNKKEVIVTYTDASGKQTLTVDKLLVAVGRKAATKGLLADGTGVQLNERGQIVVDEHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFETIPWVIYTEPEIAWVGKTEQELKADNIPYKAGSFPFAAVGRAVAM
    AEPSGFAKVLAHAETDRVLGLHLIGVNVSELVHEGVLAMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRSIHKAN

    >gi|28198723|ref|NP_779037.1| thioredoxin [Xylella fastidiosa Temecula1]
    MFVLFGLGRWKHRIIRPLYGEWSLSMLWRYCMNLRVLGVVYAVLCVVCPGLLEASAVSAVQKVSSAGVADPATQQRMAHR
    PRLQGKTVIGKPYDLAAHRGKWVLVNVWATW
    CEPCLKEMPELSALYRRRRDVEVVGLAYEDSTPEEILTFLRSHPVAYPI
    ILVDVSNPPKDFAVPRGLPMSYLIAPDGTVAKQFLGSITARDVEGVIGTMGKAG

    >gi|28198764|ref|NP_779078.1| methionine sulfoxide reductase A [Xylella fastidiosa Temecula1]
    MVMTIEALKHLGRVDESRVGRTEPLPLDNRHYVNGHPLCDSFPGLALIQFGLGCFWGAERLFWQLPGVFSTAAGYAGGGV
    PYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQTFWESHDPTQGMRQGNDIGTQYRSVIHCTTSEQYAAASASREVYQ
    QQLNTAGYTAITTEILHPAPPFYYAENEHQQYLAKHPNGYCGLGGTGVTCAIRLQV

    >gi|28198803|ref|NP_779117.1| glutathione peroxidase-like protein [Xylella fastidiosa Temecula1]
    MSSIYTFTFTRLDGRPQALADWRGQVLLLVNVASRCGFTPQYAGLEMLWQRYRDAGLIVIGFPCDQFAGQEPGDEAKIAE
    FCTLTYGVDFPMAAKIKVNGADAHPLWQWLKHRRRGLFGVAAIKWNFTKFLIGRNGQPIARYSPIKSPEQLEVHIVRALG
    EEGGGNTH

    >gi|28198937|ref|NP_779251.1| organic hydroperoxide resistance protein [Xylella fastidiosa Temecula1]
    MNSPEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPAE
    PRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQNLVDKAHRV
    CPYSNATRGNIDVVLILID

    >gi|28198961|ref|NP_779275.1| hypothetical protein PD1066 [Xylella fastidiosa Temecula1]
    MNFEELQAFAGRNPILSLAFVGLTIAIVVTETALLFRRYTALKPADLTRLINSENALVVDLSPSSDFEKGHIAGSRSVVE
    SKFDPESNKLLLSAKQSPLVVV
    CRNGHISAAAAKRLKNAGFEKVYWLDGGIATWKMAEMPLIKGRT

    >gi|28199059|ref|NP_779373.1| glutathione peroxidase/vitamin B12 uptake permease [Xylella fastidiosa Temecula1]
    MNMLNVLRFPVLALALAFVSSGVLADVGSLLDLDYRPLAGKETVNLQRLYGGKVLLVVNTASKCGFTPQYEGLEALHQKL
    SPLGFAVLGFPSNDFKGQEPGDEQQIQEFCTLTYGVKFPMFQKVHVKGNEVTPLYQRLTQTTGVAPGWNFHKYLIARDGH
    VVAQFDSRTRPDDPILLEAIKRELAKSVQVVH

    >gi|28199087|ref|NP_779401.1| polyketide synthase [Xylella fastidiosa Temecula1]
    MSSPVVEIQIWSDLICPWCWIGKRRLERALRNSSLFADIKVRHRAFRLMPELIPLPVIDVLQQRYGGSAEQIVAIQQRIE
    KIAAEESLIYRLVGTQGADTLQAHRLLYLAHRQGLQEVLLERFYSAYFSEGTPIFDTDTLAPLALDVGLERTAVAALFAG
    QDFIAEIEDDQRRLQRYGANGVPFFLMDGRIAVNGAQPIEAFSDALAQLNADAASQSAFFLR

    >gi|28199115|ref|NP_779429.1| thioredoxin domain-containing protein [Xylella fastidiosa Temecula1]
    MFQDAWFFLWCLRCISSAPKLDCRVCPSSGEPLTLYRSDVSPLIHHHQLIEESLVMSDKSHVFDVTDADFETAVLKRSLE
    TPVLVDFWAPW
    CAPCRSLIPILEKLVAEYRGGFELAKINVDQEQQVAAALQVRSVPMVYLVKDGQLVDGFPGAKPETQVR
    EFLTKHGILPARSAAFREDTPAIPLDPEAEVERLRQALVAEPENNDLKLDLALALLKTNGADEAAGLIDALPAKLATDDR
    MLRAKAWLRFIEVLNGAPSLDVLQGACAADASDFDQRHLLGVHLLLDGQCEAALEHFLEMLRQNRDFKDGLPRKALIDAF
    YLIEDKELVGRYRRKMSALLF

    >gi|28199293|ref|NP_779607.1| glutaredoxin-like protein [Xylella fastidiosa Temecula1]
    MSLDSALRSRIETLLHSNRVVLFMKGRPGMPQCGFSAKAAGILQALGVEYAHVNVLDDQEIREGIKRYGDWPTIPQLYID
    GELIGGSDIVSQMYENGELSTLLGVAAPDLTPPSITITPTAVEMLKGTLANAPGSTLALSIDSRFQPTFELAPINTQAIA
    AEYNGLRVQFDLASARRAEGITIDWVDDIRGQGLVIDNPNAPQPIQELSPGDAAAQVDAGVLTLVDVRPADERAVASVAV
    PFRTMDGGERAVLEQLPKGTPLAFL
    CHHGGRSLQAAEHFRSLGFTSIYNIGGGIDAWSTQVDPGVPKY

    >gi|28199361|ref|NP_779675.1| c-type cytochrome biogenesis protein/thioredoxin [Xylella fastidiosa Temecula1]
    MSDSPRRFPTPLLLTGVMGVLILIALLTFTLMRSWDNASDQSALLGKPAPNFSLPLLHDPSLQISNTDLAGAPYLLHVWG
    SW
    CAACATEQPVLTHFALSKRVRVIGYNWKDRREDALQWLEQLGNPYLAVVSDPEGKTAIDWGVTAAPTTFLIDGRGIVR
    WHHKGALNQQMIEHKLLPILADIEHSPTAAPALHQAP

    >gi|28199414|ref|NP_779728.1| c-type cytochrome biogenesis protein [Xylella fastidiosa Temecula1]
    MTFLHRLATLCVLALISFPVVAVSETDLLPVEKAFVVGVKALDRHHVLVHWKIAEGYYLYRHRIAVRVLNDGVLKSDSKL
    NLPNGYRKNDSYLGDVEIYRGSLTAVRSVLPVKGVHKLTLQVNYQGCADAGVCYPPQVRTLHVALPTDGNDLDRGAVVDR
    QDRGSAVDARPLLSEIVPGVRALPLPAEQAFGFEAIVGDGNHLLLRFTPAKGYYLYRDRTSLALEGDKTVHTGVAYWPQG
    SKYHDEHFGDVVVYFNQIEVMLPLQRDYSGPIANATLVATFQGCQIDGICYPPMTRRVRLSLPSGKVSSPNRANAIPLMG
    NHASLQNPLRLPGSNVPPATASQSAVSVDSALENHPSYSASKFFMALSLALVGGLLLNLLPCVLPVLSLKVLALAKSGES
    RACARRHAIWYTAGVLLSFGVIGGIAIMAKILWGFQLQQPGFVGVLVYLMFAVGLSLSGVFTMSSTKFGAIGQSLMARSG
    SLGDFFAGVLACVVSSACIGPFMGPALVYAFTAPPLLAMLVFLTLGFGLALPFLLLGFVPSLTRRLPTPGPWMQTLKYVL
    ALPMYLTAIWLLWVLGKQRGVDAQSLLLVGLVMLAMGLCWFERSRWNADRWGLVLSSVLLLLTLLPLWGVTQLKIPHSIP
    QNVSSDEVAYSPLLLDRLRADNRVVFVNVTADW
    CVTCKANERNVLSSDAFHDVMHRIDAVYMKGDWTNGDAQISAFLSQH
    QAVGVPLYVVYGPGAPPNILPNVLTKDVVEDALLRAAR

    >gi|77747707|ref|NP_779809.2| molybdopterin biosynthesis protein MoeB [Xylella fastidiosa Temecula1]
    MSIAEITPHQARSRAASGAVFIDVRQSYERVSGQAEGALGIDQATLEAHSSTHLPDTNAEIVLICQSGQRSRHTGERLQA
    AGYRRLYSVAGGTDAWRKAGLPLLRPILSTDEQDFMERYARHLRLPHIGPHGQQRLAEARVLLIGAGGLGSPAAFYLTAA
    GVGHLRIADHDTVERSNLQRQILHVDAELGVPKAASAARRLSALNPRVQVEAMQVRANSSNIETLLQDVDVAIDGADNFP
    ARYLLNDACVKMGTPLVYGAVHQFQGQVSVFDAGRQRGQAPCYRCLFPEPPHPEFAPS
    CSEVGVLGVLPGVIGMLQATEA
    LKLLLDIGKPLRGRVLCFDALAMQFREIRLAPDPTCPVCAPGRPFPGYIDYAAFCRNPL

    >gi|28199544|ref|NP_779858.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa Temecula1]
    MTMLISLPTAPSVPNYQSLERPLNFTMAAAAKVRELIQEENNADLALRVYIQGGGCSGFQYGFEFDENRADDDLALETDG
    VVLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV

    >gi|28199585|ref|NP_779899.1| disulfide bond formation protein B [Xylella fastidiosa Temecula1]
    MNALQWSFRAQCLTGFLFCTGLLAYAIFLQLHQGLEPCPLCIFQRIAFAVLGILFLIAGLYNSSNVYTRKAYGLLIFLTA
    IIGTGIAGRHVWVQLMPHNTISS
    CGSPLSFLSETMGPFEVFRTVLTGTSNCGNIDWRFLGLSMPMWSMFWFVALALLGLL
    VGFKAERRKPLFS

    >gi|28199612|ref|NP_779926.1| bacterioferritin comigratory protein [Xylella fastidiosa Temecula1]
    MNIGDTLNHSLLNHPLMLSGGTCKTLSDYTNQWLVLYFYPKDNTPGCTTEGLEFNVLLPQFKQINATVLGVSRDSVKSHD
    SFCAKQGFTFPLVSDSDALLCKAFDVIKEKTMYGRQIIGIERSTFLIGPTHRIVEAWRQVKVPGHAEEVLTKLKAHAEQ

    >gi|28199645|ref|NP_779959.1| stringent starvation protein A [Xylella fastidiosa Temecula1]
    MAVNVRMRNTLTLFSSANDVLCHRVRLVLAAKGVNYEMVSVDPQNPPEDLIDLNPYHSVPTLVERELVLYAASVVTEYVD
    ERYPHPRLMPMDPLSRARLRLAMLRIEHDWVPQVQAVQLGNKTQAEAGRKRLKELLMASLPLFKASKFFLNAEMSLADCA
    MAPIIWRLQALDVSLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDFVV

    >gi|28199681|ref|NP_779995.1| dihydrolipoamide dehydrogenase [Xylella fastidiosa Temecula1]
    MTVIEIKVPDIGDYSKVPVIEVLVTVGDHLVKNQGILTLESDKATLEVPSMNNGIVKELKVNVGDLLSQGDVILLLETED
    TTAPPSPSNAATSDTTSPPPPSPQPAASKPTAPDQQHSDIKCRMVVLGAGPGGYTAAFRAADLGLDTVLVERYPNLGGV
    C
    LNVGCIPSKALLHAAAVIDEAAHASTFGIDFGKPKITLDTLREYKQNVVNKLTAGLAGMAKQRKVRTVTGIAHFVSPNTL
    DITAADGSTQRLHFQQCIIATGSHPVKLPNFPWDDPRIMDSTDALELAEVPKKLLVVGGGIIGLEMATVYNALGSHVTIV
    EFMDQIIPGTDKDLVKPLADRMKKQGIEIHLNTKASHVKADKKGITVSFEAPTQGTQPALKTSTYDRVLVAVGRTPTGNN
    IGAEKAGVNVTERGFIPVDRQMRSNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAAETESGKHREWVARVIPSVAYTN
    PEIAWIGITETEAKAKGLNIGVAKFPWVASGRAIGIGRTEGFTKLIFDEDTHRIIGGAIVGVHAGDLLAEIGLAIEMGAE
    AEDISHTIHAHPTLSESIAMSAEVYDGTITDLYLPKKSATSAK

    >gi|28199695|ref|NP_780009.1| methionine sulfoxide reductase B [Xylella fastidiosa Temecula1]
    MNVTFDLTPPSPSQREALIATLNAEERRILLQHGTEAPFCNRLLDNNQLGTYTCRLCGLPLFHSNAKFKSGTGWPSFFEP
    YTHTHIRKQHDTSHGMIRTEILCARCNSHLGHLFPDGPPPTYERY
    CLNSVSLTFIPTGTLLPDQLHRGDNTTYRT

    >gi|28199760|ref|NP_780074.1| hypothetical protein PD1892 [Xylella fastidiosa Temecula1]
    MSEYWYPILGGILLGLSTVMLLLLNGRIAGISGIVGRLLQGGNPAQNIPFVVGLVLGPLLFTVIFDRFPSVTVAATWPTI
    IVAGLLVGLGTRMGAG
    CTSGHGIVGIARHSPRSIVATAIFLISGMATATFMGVYQ

    >gi|28199813|ref|NP_780127.1| hypothetical protein PD1946 [Xylella fastidiosa Temecula1]
    MTVTLTPVALDRVRRFIQQTPGTLGLRFGVTRTGCSGWGHFTDLACEQREGDSVFEQDGVRIFVDAHSLPLVDGTCIDFS
    KRGLSETFTFVNPNAAVECGCGESFTTDVDKA

    >gi|28199838|ref|NP_780152.1| glutaredoxin [Xylella fastidiosa Temecula1]
    MKQDSTRDEAGSTPKITIYSTAICPYCVAAKNFLKSKGYTWTEIMINVNSAEREKMIARTQRTSVPQIFVGDTHVGGYDD
    MMALHHAGKLEPLLTNHSPQG

    >gi|28199841|ref|NP_780155.1| 6-O-methylguanine-DNA methyltransferase [Xylella fastidiosa Temecula1]
    MSQLCYDIFDSPIGILTIVADTDALCRVMLPSNDHTTKEHECWHYAPSTTLLKQARTQLLDYLHGELHTFSLPLRPQGTP
    FQCAVWKALAHISFGQTWSYAKLAAHIGRPSASRAVGAANARNPLPIVLP
    CHRVIGSNGALTGFNGGLHIKRSLLYLEGT
    KPTHTCKTIMTS

    >gi|28199858|ref|NP_780172.1| hypothetical protein PD1992 [Xylella fastidiosa Temecula1]
    MWPLRFNNRFIDVLPCDPEVSLRSRQVLEAWSRVAPTPVPMPCLLAYSSEVAAILNFDAEELVTPRFVEVFSGNALYTGM
    QPYAVNYGGHQFGQWVGQLGDGRVITLGELLGADGVYYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMHHLGIPT
    TRALSLIATGDTVIRDMLYDGHPAPEPSAIVCRVAPSFIRFGTFELPASRGDIDLLRRLVEFTIIRDYPHLHGAGETLYA
    DWFAEICTRTAELVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWIDNNDLDWTPNVTDVQSRRYRFGAQPQVAYWNLG
    CLARALAPLFSDAASLQAGLERFRATYLAAERRDAAAKLGFAACFDEDLELFDALRTCMHQAEMDMTLTFLGLADWEPNM
    PDSLSLWAEAFYDPVKRDAQAPMLRDWLQRYAARLSVDPLPVAERHERMRLANPRYVLRNYLTQQAIECAEQGDLTELHA
    LLEVMRRPYDFQLGREAYAMRRPEWARSRIG
    CSMLSCSS

    >gi|28199895|ref|NP_780209.1| hypothetical protein PD2034 [Xylella fastidiosa Temecula1]
    MLVMERIQAEIEEHPLVLFMKGTLEFPMCGYSSRATQALLAAGARHLHIVNVLAEAEIRANLPRFSNWLTFPQLFIHGEL
    IGGCEIILELFESGDLKRILSEAD

    >gi|28199915|ref|NP_780229.1| thioredoxin [Xylella fastidiosa Temecula1]
    MSDYVLHISDANFDAMVLLSDQPVLVDFWAKWCGPCKIISTLLDDLAQSYEGRLKIAKVDIDENRALAIKYHVCSIPMLL
    LFKDGQVQITQTGAVGKGRLTQMIDKVLANTDS