Xylella fastidiosa M23 uid58809

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|182680651|ref|YP_001828811.1| arsenate reductase and related [Xylella fastidiosa M23]
    MTTLYGLKNCDTCKKANKWLDRFSIAYVFVDYCENIPSPETLVTWSKEAGSFDALINKSSTTWRQLPSNRKTPCSEAEWK
    LLLREYPHLIRRPVVLTSDGIFSQGFSDNGFKKRFGID

    >gi|182681038|ref|YP_001829198.1| thioredoxin domain-containing protein [Xylella fastidiosa M23]
    MQIITATSPDEFNAALKAHSRLLVDFYKEHCPGCRMLDMALNKFAATDAAAGVVVLKIRLETIGEDFFRDLGLRQTPTLG
    VFKNGLEVSRLLGFQSLAQIEAAVQTYL

    >gi|182681045|ref|YP_001829205.1| glutathione S-transferase domain-containing protein [Xylella fastidiosa M23]
    MKLYIKPGACSLADHILLRWSGSSFDLQFLDHQSMKAPEYLALNPSGAVPALQVGDWVLTQNAAILNYITDIAPAECGLS
    GDGSLKARAEINRWIAFSSSDVHPMYWALFGGTTYLQDPQMIARSQDNARQKLRVLYQRADAHLKHHNWLANGQRSGADA
    YLYVTLRWAKKVGVDLSSLDALSAFFERMEADPGVQAALQAEGLI

    >gi|182681238|ref|YP_001829398.1| disulfide isomerase [Xylella fastidiosa M23]
    MYRLIAALLLGIVTLTACAQPSQPSSNKTSTTPTNTTPANVQQRVTAALNTLDPDFKPDYIGAAPFPGFREVVVSGQILY
    VSDNGRYLIQAQPYDIQNKKFAVSEGLLSYRRTQLATVPQSQRIVFAPKNPQYTISVFTDIE
    CGYCRKLHSEIAELNKQG
    IAVEYLAFPRMGLGSEDYKDMVSVWCAADRKQALTEAKAGKKIQNKNCNNPVALEYSLGQRIGVNGTPAIFAPDGTQLGG
    YLPPEKLRALLDKLAAATAKGG

    >gi|182681247|ref|YP_001829407.1| DSBA oxidoreductase [Xylella fastidiosa M23]
    MSLFGRLLSLLLAFVPLSICAAVNHLPVVGEDYVEIPDGRPFAPLAGKIEVVEIFGYTCPHCAHFDSKLQAWGARQAKDV
    RFTLVPAVFGGVWDPFARAYLAADVLGVAKRSHAAMFEAIHEKGSVPIQNVGPDELAVFYAGYGVQPDRFVATFNGPEVE
    KRFQAARAYALKVRPVGTPAIVVDGRYMVTGHDFDDTLRITDYLVSRERAASHGR

    >gi|182681248|ref|YP_001829408.1| DSBA oxidoreductase [Xylella fastidiosa M23]
    MKNRFAMMLMALLPVLVACQAKDGSADTVQSAVPAPSAPPSSSTATTTPTTPPPESARPVEASRVPSGPKPVAGTDYVVI
    QDGQQFQPVSGKVEVVEVFGYI
    CPACFQFQPQIALWKAGLASDVNFVYVPAVFGGPWDDYARAFYAAETLNLQEKTHQQL
    YKAIHVDRTLKGERGRDTVQDIANFYAKFGVNPEQFVNTMSSFGISAKVNRAKQFAKHSQVTGTPSLIINGKYLVKGRTY
    DDMLRIADHLIEGERKVLGK

    >gi|182681258|ref|YP_001829418.1| thioredoxin reductase [Xylella fastidiosa M23]
    MSDYPASAKHSRLLILGSGPAGWTAAVYAARANLQPVLITGLQQGGQLMTTTEVDNWPGDAHGLMGPDLMERMQAHAERF
    ETEVIFDQIYKADLSTRPFTLFGDSGIYTCDGLIIATGANAKYLGIPSEEAFKGRGVSA
    CATCDGFFYRDQDVAVIGGGN
    TAVEEALYLSNIARKVYLIHRRDKLRAEKIMQNKLFSKAATGKIELIWNNAVEEVLGNDAGVTGVRIRSTQDSSTRDIDV
    QGLFVAIGHHPNTDLFAGQLAMNNGYLQIHSGTAGNVTQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDKG
    N

    >gi|182681296|ref|YP_001829456.1| hypothetical protein XfasM23_0742 [Xylella fastidiosa M23]
    MTRMNAILLGSVLRIFIITFMILIAACQVSLPDSVMPRPVDTTMHKLSVADPTQPVTSGNTPTAADIAAVAALNAEFDPG
    RDPVADLATAKVEAKRGGKQIILSIGSKR
    CSWCRVMDEFINGDAEIRSFRDAHFIWMKVNVSDENKNEVFLARFPKVKNY
    PHLFVLDADAKLLSSRFTADFEKGHSYDRRRFFAFLRQSVPSKN

    >gi|182681334|ref|YP_001829494.1| peroxiredoxin [Xylella fastidiosa M23]
    MSVLNTEILSFKATAYKNGQFVEVSEAVFKGKWAVFVFYPADFTFVCPTELEDLADHYEEFQKYGVEIYSVSTDTHFSHK
    AWHDISPAIGKIKYAMIGDPTHEISRNFNVLRPSGLADRGTFIIDPQGVIQSVEITAEGIGRDAKELLRKVKAAIYVANH
    PGEVCPAKWEEGGKTLAPSLDLVGKI

    >gi|182681335|ref|YP_001829495.1| alkyl hydroperoxide reductase, F subunit [Xylella fastidiosa M23]
    MFDESLKAQLKAYLDRVIRSIHIHASVDESHKSREMLDLLENIVLLSGKKVVLEVHRDDDKRKPSFGLSTPGESISIRFA
    GLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHYRFETYFSVS
    CQSCPDVVQALNMAAVLNPQIEHVAIDGALF
    QDEVEARQIMSVPTVYLNGELFGQGRMTLEQIVAKLDSGAAKRTAESIQAKAVFDVLVVGAGPAGVAAAVYAARKGVRTG
    LVAERFGGQVLDTMTIENFISVPETDGPRMAAALEQHVRQYEVDIMNLQRVETLVPAGENGFIEVRLASGASLSSRTVIL
    STGARWRQMNVPGEDEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIASYVTLLEFDTKLRADEVLQRKL
    RSMSNVEVIMGAQTTEVRGDGKKVTGLVYVDRSTGGSFILALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDERGHTSL
    PGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRNVVEITGIAQAQAA

    >gi|182681353|ref|YP_001829513.1| dihydrolipoamide dehydrogenase [Xylella fastidiosa M23]
    MSEHYDVVVIGAGPAGYHAAIRAAQLGLKVACVDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQYWNMGHLFNEHGIS
    FKDAKMDIATMIARKDKIVKQFTGGIAMLFKANKITPYYGFAQLQPGNVVKVKQHEGKNIELKGANVILASGSDSVELPF
    ATFDGETIVDNIGALDFTKVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEAMPNFLAAVDADVAKTAAKEFKQQGLDIK
    LGAKVSRTEISSKNNKKEVIVTYTDASGKQTLTVDKLLVAVGRKAATKGLLADGTGVQLNERGQIVVDEHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFETIPWVIYTEPEIAWVGKTEQELKADNIPYKAGSFPFAAVGRAVAM
    AEPSGFAKVLAHAETDRVLGLHLIGVNVSELVHEGVLAMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRSIHKAN

    >gi|182681416|ref|YP_001829576.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Xylella fastidiosa M23]
    MNLRVLGVVYAVLCVVCPGLLEASAVSAVQKVSSAGVADPATQQRMAHRPRLQGKTVIGKPYDLAAHRGKWVLVNVWATW
    CEPCLKEMPELSALYRRRRDVEVVGLAYEDSTPEEILTFLRSHPVAYPIILVDVSNPPKDFAVPRGLPMSYLIAPDGTVA
    KQFLGSITARDVEGVIGTMGKAG

    >gi|182681457|ref|YP_001829617.1| methionine sulfoxide reductase A [Xylella fastidiosa M23]
    MVMTIEALKHLGRVDESRVGRTEPLPLDNRHYVNGHPLCDSFPGLALIQFGLGCFWGAERLFWQLPGVFSTAAGYAGGGV
    PYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQTFWESHDPTQGMRQGNDIGTQYRSVIHCTTSEQYAAASASREVYQ
    QQLNTAGYTAITTEILHPAPPFYYAENEHQQYLAKHPNGYCGLGGTGVTCAIRLQV

    >gi|182681502|ref|YP_001829662.1| glutathione peroxidase [Xylella fastidiosa M23]
    MSSIYTFTFTRLDGRPQALADWRGQVLLLVNVASRCGFTPQYAGLEMLWQRYRDAGLIVIGFPCDQFAGQEPGDEAKIAE
    FCTLTYGVDFPMAAKIKVNGADAHPLWQWLKHRRRGLFGVAAIKWNFTKFLIGRNGQPIARYSPIKSPEQLEVHIVRALG
    EEGGGNTH

    >gi|182681646|ref|YP_001829806.1| OsmC family protein [Xylella fastidiosa M23]
    MNSPEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPAE
    PRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQNLVDKAHRV
    CPYSNATRGNIDVVLILID

    >gi|182681673|ref|YP_001829833.1| rhodanese domain-containing protein [Xylella fastidiosa M23]
    MNFEELQAFAGRNPILSLAFVGLTIAIVVTETALLFRRYTALKPADLTRLINSENALVVDLSPSSDFEKGHIAGSRSVVE
    SKFDPESNKLLLSAKQSPLVVV
    CRNGHISAAAAKRLKNAGFEKVYWLDGGIATWKMAEMPLIKGRT

    >gi|182681785|ref|YP_001829945.1| glutathione peroxidase [Xylella fastidiosa M23]
    MNMLNVLRFPVLALALAFVSSGVLADVGSLLDLDYRPLAGKETVNLQRLYGGKVLLVVNTASKCGFTPQYEGLEALHQKL
    SPLGFAVLGFPSNDFKGQEPGDEQQIQEFCTLTYGVKFPMFQKVHVKGNEVTPLYQRLTQTTGVAPGWNFHKYLIARDGH
    VVAQFDSRTRPDDPILLEAIKRELAKSVQVVH

    >gi|182681814|ref|YP_001829974.1| DSBA oxidoreductase [Xylella fastidiosa M23]
    MSSPVVEIQIWSDLICPWCWIGKRRLERALRNSSLFADIKVRHRAFRLMPELIPLPVIDVLQQRYGGSAEQIVAIQQRIE
    KIAAEESLIYRLVGTQGADTLQAHRLLYLAHRQGLQEVLLERFYSAYFSEGTPIFDTDTLAPLALDVGLERTAVAALFAG
    QDFIAEIEDDQRRLQRYGANGVPFFLMDGRIAVNGAQPIEAFSDALAQLNADAASQSAFFLR

    >gi|182681842|ref|YP_001830002.1| thioredoxin [Xylella fastidiosa M23]
    MSDKSHVFDVTDADFETAVLKRSLETPVLVDFWAPWCAPCRSLIPILEKLVAEYRGGFELAKINVDQEQQVAAALQVRSV
    PMVYLVKDGQLVDGFPGAKPETQVREFLTKHGILPARSAAFREDTPAIPLDPEAEVERLRQALVAEPENNDLKLDLALAL
    LKTNGADEAAGLIDALPAKLATDDRMLRAKAWLRFIEVLNGAPSLDVLQGACAADASDFDQRHLLGVHLLLDGQCEAALE
    HFLEMLRQNRDFKDGLPRKALIDAFYLIEDKELVGRYRRKMSALLF

    >gi|182682020|ref|YP_001830180.1| glutaredoxin-like protein [Xylella fastidiosa M23]
    MSLDSALRSRIETLLHSNRVVLFMKGRPGMPQCGFSAKAAGILQALGVEYAHVNVLDDQEIREGIKRYGDWPTIPQLYID
    GELIGGSDIVSQMYENGELSTLLGVAAPDLTPPSITITPTAVEMLKGTLANAPGSTLALSIDSRFQPTFELAPINTQAIA
    AEYNGLRVQFDLASARRAEGITIDWVDDIRGQGLVIDNPNAPQPIQELSPGDAAAQVDAGVLTLVDVRPADERAVASVAV
    PFRTMDGGERAVLEQLPKGTPLAFL
    CHHGGRSLQAAEHFRSLGFTSIYNIGGGIDAWSTQVDPGVPKY

    >gi|182682088|ref|YP_001830248.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Xylella fastidiosa M23]
    MSDSPRRFPTPLLLTGVMGVLILIALLTFTLMRSWDNASDQSALLGKPAPNFSLPLLHDPSLQISNTDLAGAPYLLHVWG
    SW
    CAACATEQPVLTHFALSKRVRVIGYNWKDRREDALQWLEQLGNPYLAVVSDPEGKTAIDWGVTAAPTTFLIDGRGIVR
    WHHKGALNQQMIEHKLLPILADIEHSPTAAPALHQAP

    >gi|182682142|ref|YP_001830302.1| cytochrome c biogenesis protein transmembrane region [Xylella fastidiosa M23]
    MTFLHRLATLCVLALISFPVVAVSETDLLPVEKAFVVGVKALDRHHVLVHWKIAEGYYLYRHRIAVRVLNDGVLKSDSKL
    NLPNGYRKNDSYLGDVEIYRGSLTAVRSVLPVKGVHKLTLQVNYQGCADAGVCYPPQVRTLHVALPTDGNDLDRGAVVDR
    QDRGSAVDARPLLSEIVPGVRALPLPAEQAFGFEAIVGDGNHLLLRFTPAKGYYLYRDRTSLALEGDKTVHTGVAYWPQG
    SKYHDEHFGDVVVYFNQIEVMLPLQRDYSGPIANATLVATFQGCQIDGICYPPMTRRVRLSLPSGKVSSPNRANAIPLMG
    NHASLQNPLRLPGSNVPPATASQSAVSVDSALENHPSYSASKFFMALSLALVGGLLLNLLPCVLPVLSLKVLALAKSGES
    RACARRHAIWYTAGVLLSFGVIGGIAIMAKILWGFQLQQPGFVGVLVYLMFAVGLSLSGVFTMSSTKFGAIGQSLMARSG
    SLGDFFAGVLACVVSSACIGPFMGPALVYAFTAPPLLAMLVFLTLGFGLALPFLLLGFVPSLTRRLPTPGPWMQTLKYVL
    ALPMYLTAIWLLWVLGKQRGVDAQSLLLVGLVMLAMGLCWFERSRWNADRWGLVLSSVLLLLTLLPLWGVTQLKIPHSIP
    QNVSSDEVAYSPLLLDRLRADNRVVFVNVTADW
    CVTCKANERNVLSSDAFHDVMHRIDAVYMKGDWTNGDAQISAFLSQH
    QAVGVPLYVVYGPGAPPNILPNVLTKDVVEDALLRAAR

    >gi|182682228|ref|YP_001830388.1| molybdopterin biosynthesis protein MoeB [Xylella fastidiosa M23]
    MSIAEITPHQARSRAASGAVFIDVRQSYERVSGQAEGALGIDQATLEAHSSTHLPDTNAEIVLICQSGQRSRHTGERLQA
    AGYRRLYSVAGGTDAWRKAGLPLLRPILSTDEQDFMERYARHLRLPHIGPHGQQRLAEARVLLIGAGGLGSPAAFYLTAA
    GVGHLRIADHDTVERSNLQRQILHVDAELGVPKAASAARRLSALNPRVQVEAMQVRANSSNIETLLQDVDVAIDGADNFP
    ARYLLNDACVKMGTPLVYGAVHQFQGQVSVFDAGRQRGQAPCYRCLFPEPPHPEFAPS
    CSEVGVLGVLPGVIGMLQATEA
    LKLLLDIGKPLRGRVLCFDALAMQFREIRLAPDPTCPVCAPGRPFPGYIDYAAFCRNPL

    >gi|182682281|ref|YP_001830441.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa M23]
    MTMLISLPTAPSVPNYQSLERPLNFTMAAAAKVRELIQEENNADLALRVYIQGGGCSGFQYGFEFDENRADDDLALETDG
    VVLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV

    >gi|182682322|ref|YP_001830482.1| disulfide bond formation protein B [Xylella fastidiosa M23]
    MNALQWSFRAQCLTGFLFCTGLLAYAIFLQLHQGLEPCPLCIFQRIAFAVLGILFLIAGLYNSSNVYTRKAYGLLIFLTA
    IIGTGIAGRHVWVQLMPHNTISS
    CGSPLSFLSETMGPFEVFRTVLTGTSNCGNIDWRFLGLSMPMWSMFWFVALALLGLL
    VGFKAERRKPLFS

    >gi|182682354|ref|YP_001830514.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Xylella fastidiosa M23]
    MNIGDTLNHSLLNHPLMLSGGTCKTLSDYTNQWLVLYFYPKDNTPGCTTEGLEFNVLLPQFKQINATVLGVSRDSVKSHD
    SFCAKQGFTFPLVSDSDALLCKAFDVIKEKTMYGRQIIGIERSTFLIGPTHRIVEAWRQVKVPGHAEEVLTKLKAHAEQ

    >gi|182682391|ref|YP_001830551.1| glutathione S-transferase domain-containing protein [Xylella fastidiosa M23]
    MAVNVRMRNTLTLFSSANDVLCHRVRLVLAAKGVNYEMVSVDPQNPPEDLIDLNPYHSVPTLVERELVLYAASVVTEYVD
    ERYPHPRLMPMDPLSRARLRLAMLRIEHDWVPQVQAVQLGNKTQAEAGRKRLKELLMASLPLFKASKFFLNAEMSLADCA
    MAPIIWRLQALDVSLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDFVV

    >gi|182682425|ref|YP_001830585.1| dihydrolipoamide dehydrogenase [Xylella fastidiosa M23]
    MTVIEIKVPDIGDYSKVPVIEVLVTVGDHLVKNQGILTLESDKATLEVPSMNNGIVKELKVNVGDLLSQGDVILLLETED
    TTAPPSPSNAATSDTTSPPPPSPQPAASKPTAPDQQHSDIKCRMVVLGAGPGGYTAAFRAADLGLDTVLVERYPNLGGV
    C
    LNVGCIPSKALLHAAAVIDEAAHASTFGIDFGKPKITLDTLREYKQNVVNKLTAGLAGMAKQRKVRTVTGIAHFVSPNTL
    DITAADGSTQRLHFQQCIIATGSHPVKLPNFPWDDPRIMDSTDALELAEVPKKLLVVGGGIIGLEMATVYNALGSHVTIV
    EFMDQIIPGTDKDLVKPLADRMKKQGIEIHLNTKASHVKADKKGITVSFEAPTQGTQPALKTSTYDRVLVAVGRTPTGNN
    IGAEKAGVNVTERGFIPVDRQMRSNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAAETESGKHREWVARVIPSVAYTN
    PEIAWIGITETEAKAKGLNIGVAKFPWVASGRAIGIGRTEGFTKLIFDEDTHRIIGGAIVGVHAGDLLAEIGLAIEMGAE
    AEDISHTIHAHPTLSESIAMSAEVYDGTITDLYLPKKSATSAK

    >gi|182682439|ref|YP_001830599.1| methionine sulfoxide reductase B [Xylella fastidiosa M23]
    MNVTFDLTPPSPSQREALIATLNAEERRILLQHGTEAPFCNRLLDNNQLGTYTCRLCGLPLFHSNAKFKSGTGWPSFFEP
    YTHTHIRKQHDTSHGMIRTEILCARCNSHLGHLFPDGPPPTYERY
    CLNSVSLTFIPTGTLLPDQLHRGDNTTYRT

    >gi|182682510|ref|YP_001830670.1| protein of unknown function DUF395 YeeE/YedE [Xylella fastidiosa M23]
    MSEYWYPILGGILLGLSTVMLLLLNGRIAGISGIVGRLLQGGNPAQNIPFVVGLVLGPLLFTVIFDRFPSVTVAATWPTI
    IVAGLLVGLGTRMGAG
    CTSGHGIVGIARHSPRSIVATAIFLISGMATATFMGVYQ

    >gi|182682565|ref|YP_001830725.1| iron-sulfur cluster assembly accessory protein [Xylella fastidiosa M23]
    MTVTLTPVALDRVRRFIQQTPGTLGLRFGVTRTGCSGWGHFTDLACEQREGDSVFEQDGVRIFVDAHSLPLVDGTCIDFS
    KRGLSETFTFVNPNAAVECGCGESFTTDVDKA

    >gi|182682588|ref|YP_001830748.1| glutaredoxin 3 [Xylella fastidiosa M23]
    MKQDSTRDEAGSTPKITIYSTAICPYCVAAKNFLKSKGYTWTEIMINVNSAEREKMIARTQRTSVPQIFVGDTHVGGYDD
    MMALHHAGKLEPLLTNHSPQG

    >gi|182682591|ref|YP_001830751.1| methylated-DNA--protein-cysteine methyltransferase [Xylella fastidiosa M23]
    MSQLCYDIFDSPIGILTIVADTDALCRVMLPSNDHTTKEHECWHYAPSTTLLKQARTQLLDYLHGELHTFSLPLRPQGTP
    FQCAVWKALAHISFGQTWSYAKLAAHIGRPSASRAVGAANARNPLPIVLP
    CHRVIGSNGALTGFNGGLHIKRSLLYLEGT
    KPTHTCKTIMTS

    >gi|182682609|ref|YP_001830769.1| hypothetical protein XfasM23_2097 [Xylella fastidiosa M23]
    MAYLIHMWPLRFNNRFIDVLPCDPEVSLRSRQVLEAWSRVAPTPVPMPCLLAYSSEVAAILNFDAEELVTPRFVEVFSGN
    ALYTGMQPYAVNYGGHQFGQWVGQLGDGRVITLGELLGADGVYYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMH
    HLGIPTTRALSLIATGDTVIRDMLYDGHPAPEPSAIVCRVAPSFIRFGTFELPASRGDIDLLRRLVEFTIIRDYPHLHGA
    GETLYADWFAEICTRTAELVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWIDNNDLDWTPNVTDVQSRRYRFGAQPQV
    AYWNLGCLARALAPLFSDAASLQAGLERFRATYLAAERRDAAAKLGFAACFDEDLELFDALRTCMHQAEMDMTLTFLGLA
    DWEPNMPDSLSLWAEAFYDPVKRDAQAPMLRDWLQRYAARLSVDPLPVAERHERMRLANPRYVLRNYLTQQAIECAEQGD
    LTELHALLEVMRRPYDFQLGREAYAMRRPEWARSRIG
    CSMLSCSS

    >gi|182682644|ref|YP_001830804.1| glutaredoxin-like protein [Xylella fastidiosa M23]
    MLVMERIQAEIEEHPLVLFMKGTLEFPMCGYSSRATQALLAAGARHLHIVNVLAEAEIRANLPRFSNWLTFPQLFIHGEL
    IGGCEIILELFESGDLKRILSEAD

    >gi|182682667|ref|YP_001830827.1| thioredoxin [Xylella fastidiosa M23]
    MSDYVLHISDANFDAMVLLSDQPVLVDFWAKWCGPCKIISTLLDDLAQSYEGRLKIAKVDIDENRALAIKYHVCSIPMLL
    LFKDGQVQITQTGAVGKGRLTQMIDKVLANTDS