Xylella fastidiosa M12 uid58763

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170729331|ref|YP_001774764.1| hypothetical protein Xfasm12_0094 [Xylella fastidiosa M12]
    MTTLYGLKNCDTCKKANQWLDRFGIPYVFVDYRENIPAPEMLVAWAKEAGGFEALINKSSTTWRQLPTSRKTPGSQAEWK
    LLLREYPQLIRRPVLVASDGSFSQGFSDNGFKQRFGVD

    >gi|170729743|ref|YP_001775176.1| thioredoxin [Xylella fastidiosa M12]
    MQIITATSPDEFNAALKAHSRLLVDFYKEHCPGCRMLDMALNKFAATDAAAGVVVLKIRLETIGEDFFRDLGLRQTPTLG
    VFKNGLEVSRLLGFQSLAQIEAAVQTYL

    >gi|170729751|ref|YP_001775184.1| glutathione S-transferase-like protein [Xylella fastidiosa M12]
    MHNSVPLLLRSSSMKLYIKPGACSLADHILLRWSGSSFDLQFLDHQSMKAPEYLALNPSGAVPALQVGDWVLTQNAAILN
    YITDIAPAERGLSGDGSLKARAEINRWIAFSSSDVHPMYWALFGGTTYLQDPQMIARSQDNLARNCVCCTSVLMHILSIT
    IGLLTDSVPVLMRICTSRCDGLKKSVWIFLVWMRYQRSLSVWRLIPGCRLHYRRKG

    >gi|170729958|ref|YP_001775391.1| chitinase [Xylella fastidiosa M12]
    MYRLIAALLLGIVTLTACAQPSQPSSNKTSTTPTNATPANVQQRVTAALNTLDPDFKPDYIGAAPFPGFREVVVSGQILY
    VSDNGRYLIQAQPYDIQNKKFAVSEGLLSYRRTQLATVPQSQRIVFAPKNPQYTISVFTDIE
    CGYCRKLHSEIAELNKQG
    IAVEYLAFPRMGLGSQDYKDMVSVWCATDRKQALTEAKAGKQIQNKNCNNPVALEYSLGQRIGVNGTPAIFAPDGTQLGG
    YLPPEKLRALLDKLAAATAKGG

    >gi|170729966|ref|YP_001775399.1| thiol:disulfide interchange protein [Xylella fastidiosa M12]
    MSVFGRLLSLLLAFVPLSICAAVNHLPVVGEDYVEIPDGRPFAPLAGKIEVVEIFGYTCPHCAHFDSKLQAWGARQAKDV
    RFTLVPAVFGGVWDPFARAYLAADVLGVAKRSHAAMFEAIHEKGSVPIQNVGPDELAVFYAGYGVQSDRFVATFNGPEVE
    KRFQAARAYALKVRPVGTPTIVVDGRYMVTGHDFDDTLRITDYLVSRERAASHGR

    >gi|170729967|ref|YP_001775400.1| thiol:disulfide interchange protein [Xylella fastidiosa M12]
    MKNRFAMMLMALLPVLVACQAKDGSADTVQSAVPAPSAPLSSSTATNTPTTPPPEAARPVEASRVPSGPKPVAGTDYVVI
    QDGQQFQPVPGKVEVVEVFGYI
    CPACFQFQPQIAPWKAGLASDVNFVYVPAVFGGPWDDYARAFYAAETLNLQEKTHQQL
    YKAIHVDRTLKGERGRDTVQDIANFYAKFGVNPEQFVNTMSSFGISAKVNRAKQFAKHSQVTGTPSLIINGKYLVKGRTY
    DDMLRIADHLIEGERKVLGK

    >gi|170729978|ref|YP_001775411.1| thioredoxin reductase [Xylella fastidiosa M12]
    MSDYPASAKHSRLLILGSGPAGWTAAVYAARANLQPVLITGLQQGGQLMTTTEVDNWPGDAHGLMGPDLMERMQAHAERF
    ETEVIFDQIYKADLSTRPFTLFGDSGLYTCDGLIIATGANAKYLGIPSEEAFKGRGVSA
    CATCDGFFYRDQDVAVIGGGN
    TAVEEALYLSNIARKVYLIHRRDKLRAEKIMQNKLFSKAATGKIELIWNNAVEEVLGNDAGVTGVRIRSTQDSSTRDIDV
    QGLFVAIGHHPNTDLFAGQLAMNNGYLQIHSGTAGNVTQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDKG
    N

    >gi|170730016|ref|YP_001775449.1| hypothetical protein Xfasm12_0831 [Xylella fastidiosa M12]
    MTRMNTVLLGSVLRIFLITFMILIAACQVSLPDSVMPRPVDTTMHKLSVADPTQPVTSGNTPTAADIAAVAALNAEFDPG
    RDPVADLATAKVEAKRGGKQIILSIGSKR
    CSWCRVLDEFINGDAEIRSFRDAHFIWMKVNVSDENKNEVFLARFPKVKNY
    PHLFVLDADAKLLNSRFTADFEKGHSYDRRKFFAFLRQSVPSKN

    >gi|170730052|ref|YP_001775485.1| subunit C of alkyl hydroperoxide reductase [Xylella fastidiosa M12]
    MSVLNTEILSFKAIAYKNGQFVEVSEAVLKGKWAVFVFYPADFTFVCPTELEDLADHYEEFQKYGVEIYSVSTDTHFSHK
    AWHDISPAIGKIKYAMIGDPTHEISRNFNVLRPSGLADRGTFIIDPQGVIQSVEITAEGIGRDAKELLRKVKAAIYVANH
    PGEVCPAKWEEGGKTLAPSLDLVGKI

    >gi|170730053|ref|YP_001775486.1| subunit F of alkyl hydroperoxide reductase [Xylella fastidiosa M12]
    MFDESLKAQLKAYLDRVIRSIHIHASVDESHKSREMLDLLENIVLLSGKKVVLEVHRDDDQRKPSFGLSTPGESISIRFA
    GLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHYRFETYFSVS
    CQSCPDVVQALNMAAVLNPQIEHVAIDGALF
    QDEVEVRQIMSVPTVYLNGELFGQGRMTLEQIVAKLDSGAAKRTAESIQDKAAFDVLVVGAGPAGAAAAVYAARKGVRTG
    LVAERFGGQVLDTMTIENFISVPETDGPRMAAALEQHVRQYEVDIMNLQRVETLVPAGENGFIEVRLASGASLSSRTVIL
    STGARWRQMNVPGEDEYRNKGIAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIASYVTLLEFDTKLRADEVLQRKL
    RSMSNVEVIMGAQTTEVRGDGKKVTGLVYVDRSTGGSFILALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDERGHTSL
    PGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRNVVEITGIAQAQAA

    >gi|170730068|ref|YP_001775501.1| dihydrolipoamide dehydrogenase [Xylella fastidiosa M12]
    MSEHYDVVVIGAGPAGYHAAIRAAQLGLKVACVDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQYWNMGHLFNEHGIS
    FKDAKMDVATMIARKDKIVKQFTGGIAMLFKANKITPYYGFAQLQPGNVVKVKQHEGKNIELKGANVILASGSDSVELPF
    ATFDGETIVDNIGALDFTKVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEAMPNFLAAVDADVAKTAAKEFKQQGLDIK
    LGAKVSRTEISSKNNKKEVIVTYTDASGKQTLTVDKLLVAVGRKAATKGLLADGTGVQLNERGQIVVDEHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGMPGHVNFETIPWVIYTEPEIAWVGKTEQELKADSIPYKAGSFPFAAVGRAVAM
    AEPSGFVKVLAHAETDRVLGLHLIGVNVSELVHEGVLAMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN

    >gi|170730152|ref|YP_001775585.1| thioredoxin [Xylella fastidiosa M12]
    MADPATQQRMAQRPRLQGKTVIGKPYDLAAHRGNWVLVNVWATWCEPCLKEMPELSALYRRRGDVEVVGLAYEDSTPEEI
    LTFLRSHPVAYPIILVDVSNPPKDFAAPRGLPMSYLIAPDGTVAKQFLGSITARDVEGVIGAMGKAG

    >gi|170730193|ref|YP_001775626.1| methionine sulfoxide reductase A [Xylella fastidiosa M12]
    MVLTIEALKHLWRVDESRVGRTEPLPLDNRHYVNGHPLCDAFTGLAQIQFGLGCFWGAERLFWQLPGVFSTAAGYAGGGV
    PYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQTFWESHDPTQGMRQGNDIGTQYRSVIHCTTSEQYAAASASREVYQ
    QQLNTAGYTAITTEILHPAPPFYYAENEHQQYLAKHPNGYCGLGGTGVTCAIRLQV

    >gi|170730231|ref|YP_001775664.1| glutathione peroxidase [Xylella fastidiosa M12]
    MTSIYTFTFTRLDGRPQALADWRGQVLLLVNVASHCGFTPQYAGLEMLWQRYRDAGLIVIGFPCDQFAGQEPGDEAKIAE
    FCTLTYGVDFPMAAKIKVNGADAHPLWQWLKHRRRGLFGVAAIKWNFTKFLIGRNGQPIARYSPIKSPEQLEVHIVRALG
    EEGGGNTH

    >gi|170730344|ref|YP_001775777.1| organic hydroperoxide resistance protein [Xylella fastidiosa M12]
    MNSPEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPAE
    PRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRV
    CPYSNATRGNIDVVLILID

    >gi|170730500|ref|YP_001775933.1| thioredoxin [Xylella fastidiosa M12]
    MSDKSHIFDVTDADFETAVLKKSLETPVLVDFWAPWCAPCRSLIPILEKLVAEYRGGFELAKINVDQEQQVAAALQVRSV
    PMVYLVKDGQLVDGFPGAKPETQVREFLTKHGILPARSAAFGEDTPAIPLDPEAEVARLRQALAAEPENNDLKLDLALAL
    LKTNVADEAAGLIDALPAKLATDDRMLRAKAWLRFIEVLNGAPSLDVLQAACAADASDFDQRHLLGVHLLLDGQCEAALE
    HFLEMLRQNRDFKDGLPRKALIDAFYLIEDKELVGRYRRKMSALLF

    >gi|170730664|ref|YP_001776097.1| glutaredoxin-like protein [Xylella fastidiosa M12]
    MSLDSALRSRIETLLHSNRVVLFMKGRPGMPQCGFSAKAAGILQALGVEYAHVNVLDDQEIREGIKRYGDWPTIPQLYID
    GELIGGSDIVSQMYENGELSTLLGVAAPDLTPPSITITPTAVEMLKGTLANAPGSTLALSIDSRFQPTFELAPINTQAIA
    AESNGLRVQFDLASARRAEGITIDWVDDIRGQGLVIDNPNVPQPIQELSPGDAAAQVDAGVLTLVDVRPADERAVASVAV
    PFRTMDGGERAVLEQLPKGTPLAFL
    CHHGGRSLQAAEHFRSLGFTSIYNIGGGIDAWSTQVDPGVPKY

    >gi|170730729|ref|YP_001776162.1| c-type cytochrome biogenesis protein/thioredoxin [Xylella fastidiosa M12]
    MSDSPRRFPTPLLLTGVMGVLILIALLTFTLMRSWDNAPDQSALLGKPAPNFSLPLLHDPSLQISNTDLAGAPYLLHVWG
    SW
    CAACATEQPVLTHFALSKRVRVIGYNWKDRREDALQWLEQLGNPYLAVVSDPEGKTAIDWGVTAAPTTFLIDGRGIVR
    WHHKGALNQQMIEHKLLPILADIEHSPTAAPALHQAP

    >gi|170730790|ref|YP_001776223.1| C-type cytochrome biogenesis protein (copper tolerance) [Xylella fastidiosa M12]
    MTFLHRLATLCVLALISFPVVAVSETDLLPVEKAFVVGVKALDRHHVLVHWKIAEGYYLYRHRIAVRVLNDGVLKSDSKL
    NLPNGYKKNDSYLGDVEIYRGSLTAVRSVLPVKGVHKLTLQVNYQGCADAGVCYPPQVRTLHVALPTDGNDLDRGAAVDR
    QDRGSAVDARPLLSEIVPGVRALPLPAEQAFGFEAIVGDGNHLLLRFTPAKGYYLYRDRTSLALEGDKTVHTGVAYWPQG
    SKYHDEHFGDVVVYFNQIEVMLPLQRDYSGPIANATLVATFQGCQIDGICYPPMTRRVRLSLPSGKVSSPNRANAIPLMG
    NHASLQNPLRSPGSNVPSATASQSAVSVDSALENHPSYSASKFFMALSLALVGGLLLNLLPCVLPVLSLKVLALAKSGES
    RACARRHAIWYTAGVLLSFGVIGGIAIMAKILWGFQLQQPGFVGVLVYLMFAVGLSLSGVFTMSSTKFGAIGQSLMARSG
    PLGDFFAGVLACVVSSACIGPFMGPALVYAFTAPPLLAMLVFLTLGFGLALPFLLLGFVPSLTRRLPTPGPWMQTLKYVL
    ALPMYLTAIWLLWVLGKQRGVDAQSLLLVGLVMLAMGLCWFERSRWNADRWGLVLSSVLLLLTLLPLWGVTQLKIPHSIA
    QNVSSDEVAYSPLLLDRLRADNRVVFVNVTADW
    CVTCKANERNVLSSDAFHDVMHRIDAVYMKGDWTNGDAQISAFLSQH
    QAVGVPLYVVYGPGAPPNILPNVLTKDVVEDALLRAAR

    >gi|170730864|ref|YP_001776297.1| molybdopterin biosynthesis protein MoeB [Xylella fastidiosa M12]
    MSIAEITPHQARSRAASGAVFIDVRQSYERVSGQAEGALGIDQATLEAHSSTHLPDTNAEIVLICQSGQRSRHTGERLQA
    AGYRRLYSVAGGTDAWRKAGLPLLRPMLTTDEQDFMERYARHLRLPHIGPHGQQRLAEARMLLIGAGGLGSPAAFYLTAA
    GVGHLRIADHDTVERSNLQRQILHVDAELGVPKAASAARRLSALNPRVQVEAMQVRANSSNIETLLQDVDVAIDGADNFP
    ARYLLNDACVKLGTPLVYGAVHQFQGQVSVFDAGRRRGQAPCYRCLFPEPPHPEFAPS
    CSEAGVLGVLPGVIGMLQATEA
    LKLLLDIGKPLRGRVLCFDALAMQFREIRLAPDPTCPVCAPGRPFPGYIDYAAFCRNPLKQPTQRG

    >gi|170730915|ref|YP_001776348.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa M12]
    MTMLISLPTAPSVPNYQSLERPLNFTMAAAAKVRELIQEENSADLALRVYIQGGGCSGFQYGFEFDENRADDDLVLETDG
    VVLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSI

    >gi|170730959|ref|YP_001776392.1| disulfide bond formation protein B [Xylella fastidiosa M12]
    MNALQWSFRAQCLTGFLFCTGLLAYAIFLQLHQGLEPCPLCIFQRMAFAVLAILFLIAGLYNSSNVYTRKAYGLLIFLTA
    TIGTGIAGRHVWVQLMPHNTISS
    CGSPLSFLSETMGPFEVFRTVLTGTSDCGNIDWRFLGLSMPMWSMFWFVALALLGLL
    VGFKAERRKPLFS

    >gi|170730974|ref|YP_001776407.1| bacterioferritin comigratory protein [Xylella fastidiosa M12]
    MNIGDTLNHSLLNHPLMLSGGTCKTLSDYTNQWLVLYFYPKDNTPGCTTEGLEFNLLLPQFEQINATVLGVSRDSVKSHD
    SFCAKQGFTFPLVSDSDAILCKAFDVIKEKTMYGRQIIGIERSTFLIGPTHRIVEAWRQVKVPGHAEEVLTKLKAHAEQ

    >gi|170731012|ref|YP_001776445.1| stringent starvation protein A [Xylella fastidiosa M12]
    MAVNVRMRNTLTLFSSTNDVLCHRVRLVLAAKGVNYEMVSVDPQNPPEDLIDLNPYHSVPTLVERELVLYAASVVTEYVD
    ERYPHPRLMPMDPLSRARLRLAMLRIEHDWVPQVQAVQLGNKAQAEAGRKRLKELLTASLPLFKASKFFLNAEISLADCA
    MAPIIWRLQALDVSLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDFVV

    >gi|170731048|ref|YP_001776481.1| dihydrolipoamide dehydrogenase [Xylella fastidiosa M12]
    MTVIEIKVPDIGDYSKVPVIEVLVTVGDHVVKNQGILTLESDKATLEVPSMNNGVVKELKVNVGDLLSQGDVILLLETED
    TTAPPSPSNAATSDTTSPPPPSPQPAASKPTAPDQQHSDIKCRMVVLGAGPGGYTAAFRAADLGLDTVLVERYPNLGGV
    C
    LNVGCIPSKALLHAAAVIDEAAHASTFGIDFGKPKITLDTLREYKQNVVNKLTVGLAVMAKQRKVRTVTGIAHFVSPNTL
    DITAADGSTQRLHFQQCIIATGSHPVKLPNFPWDDPRIMDSTDALELAEVPKKLLVVGGGIIGLEMATVYNALGSHVTIV
    EFMDQIIPGTDKDLVKPLADRMKKQGIEIHLNTKASHVKADKKGITVSFEAPTQGTQPALKTSTYDRVLVAVGRTPTGNN
    ISAEKAGVNVTERGFIPVDRQMRSNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAAETESGKHREWVARVIPSVAYTN
    PEIAWIGMTETEAKAKGLNIGVAKFPWVASGRAIGIGRTEGFTKLIFDEDTHRIIGGAIVGVHAGDLLAEIGLAIEMGAE
    AEDISHTIHAHPTLSESIAMSAEVYDGTITDLYLPKKSATSAK

    >gi|170731068|ref|YP_001776501.1| methionine sulfoxide reductase B [Xylella fastidiosa M12]
    MKCSSNNIHSTPCTVHRRIYPQKRDLIQNIKNRIDIFHRILSSDLTMNVTFDLTPPSPSQREALIATLNAEERRILLQHG
    TEAPFCNRLLENNQPGTYTCRLCGLPLFHSNAKFKSGTGWPSFFEPYTHTHIRKQHDTSHGMIRTEILCARCNSHLGHLF
    PDGPPPTYERY
    CLNSVSLTFIPTGTLLPDQLHRGDNTTYRT

    >gi|170731136|ref|YP_001776569.1| hypothetical protein Xfasm12_2075 [Xylella fastidiosa M12]
    MSEYWYPILGGILLGLSTVMLLLLNGRIAGISGIVGRLLQGGNPAQNIPFVVGLVLGPLLFAVIFDRFPSVTVAATWPTI
    IVAGLLVGLGTRMGAG
    CTSGHGIVGIALHSPRSIVATAIFLISGMATATFMGVYQ

    >gi|170731188|ref|YP_001776621.1| hypothetical protein Xfasm12_2134 [Xylella fastidiosa M12]
    MTVTLTPVALDRVRRFIQQTPGTLGLRFGVTRTGCSGWGHFTDLACEQREGDSVFEQDGVRIFVDAHSLPLVDGTCIDFS
    KRGLSETFTFVNPNAAVECGCGESFTTDVDKA

    >gi|170731215|ref|YP_001776648.1| glutaredoxin [Xylella fastidiosa M12]
    MKQDSTRDEAGSTPKITIYSTAICPYCVAAKNFLKSKGYTWTEIMINVNSAEREKMIALTQRTSVPQIFVGDTHVGGYDD
    MMALHHAGKLEPLLTNHSPQG

    >gi|170731218|ref|YP_001776651.1| methylated-DNA--(protein)-cysteine S-methyltransferase [Xylella fastidiosa M12]
    MMSQLCYDIFDSPIGILTVVADTDALCRVMLPSNDHTTQEHECWHYAPSTTLLKQARTQLLDYLHGELHTFSLPLRPQGT
    PFQCAVWNALAHISFGQTWSYAQLAAHIGRPSASRAVGAANARNPLPIVLP
    CHRVIGSNGALTGFNGGLHIKRSLLYLEG
    TKPTHTCKTIMTS

    >gi|170731235|ref|YP_001776668.1| hypothetical protein Xfasm12_2185 [Xylella fastidiosa M12]
    MTYLIHMWPLRFNNRFIDVLPCDPEVSLRSRQVLEAWSGVAPTPVPVPCLLAYSSEVAAILNFDAEELVTPRFVEVFSGN
    ALYPGMQPYAVNYGGHQFGQWVGQLGDGRVITLGELLGADGVYYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMH
    HLGIPTTRALSLIATGDTVIRDMLYDGHPAPEPSAIVCRVAPSFIRFGTFELPASRGDIDLLRRLVEFTIMRDYPHLHGA
    GETLYADWFAEICTRTAELVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWIDNNDLDWTPNVTDVQSRRYRFGAQPQV
    AYWNLGCLARALAPLFSDAASLQAGLERFRATYLAAERRDAAAKLGFAACFDEDLALFDALRTCMHQAEMDMTLTFLGLA
    DWEPNMLDSLSLWADAFYDPVKRDAQAPMLRDWLQRYAARLSVDPLPVAERHERMRLANPRYVLRNYLTQQAIECAEQGD
    LTELHALLEVMRRPYDFQLGREAYGMRRPEWARSRIG
    CSMLSCSS

    >gi|170731273|ref|YP_001776706.1| monothiol glutaredoxin [Xylella fastidiosa M12]
    MLVMERIQAEIEEHPLVLFMKGTLEFPMCGYSSRATQALLAAGARHLHIVNVLAEAEIRANLPRFSNWPTFPQLFIHGEL
    IGGCEIILELFESGDLKRILSEAD

    >gi|170731295|ref|YP_001776728.1| thioredoxin [Xylella fastidiosa M12]
    MSDYVLHVSDANFDAMVLLSDQPVLVDFWAKWCGPCKIISTLLDDLAQSYEGRLKIVKVDIDENRALAIKYHVCSIPMLL
    LFKDGQVQITQIGAVGKGRLTQMIDKVLANTDS

    >gi|170730337|ref|YP_001775770.1| disulphide isomerase [Xylella fastidiosa M12]
    MKRWLPLLLIVLILPAQALNLPYDEHADAWTQVKKALAAGKRTHKPTLLVFGANWCTDCRALDKSLRNQKNTALIAKHFE
    VVKIDVGNFDRNLELSQAYGDPIQDGIPAIVVVNSDGKVRYTTKAGELANARKMSDQGIYDFFAKITETRGVSH