Xylella fastidiosa 9a5c uid57849

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15836720|ref|NP_297408.1| hypothetical protein XF0115 [Xylella fastidiosa 9a5c]
    MIGIVTMTTLYGLKNCDTCKKANQWLDRFGIPYVFVDYRENIPAPEMLVAWAKEAGGFEALINKSSTTWRQLPSSRKTPG
    SQAEWKLLLREYPQLIRRPVLIASDGSVSQGFSDNGFKQRFGVD

    >gi|15836942|ref|NP_297630.1| disulfide bond formation protein B [Xylella fastidiosa 9a5c]
    MNALQWSFRAQCLTGFLFCTGLLAYAIFLQLHQGLEPCPLCIFQRIAFAVLGILFLIAGLYNSSNVYTRKAYGLLIFLTA
    AIGTGIAGRHVWVQLMPHNTISS
    CGSPLSFLSETMGPFEVFRTVLTGTSDCGNIDWRFLGLSMPMWSMFWFVALALLGLL
    VGFKAERRKPLFS

    >gi|15837007|ref|NP_297695.1| iron-sulfur cluster insertion protein ErpA [Xylella fastidiosa 9a5c]
    MTMLISLPTAPSVPNYQSLERPLNFTMAAAAKVRELIQEENNADLALRVYIQGGGCSGFQYGFEFDENRADDDLALETDG
    VVLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV

    >gi|15837068|ref|NP_297756.1| molybdopterin biosynthesis protein MoeB [Xylella fastidiosa 9a5c]
    MSMTEITPHQARSRIASGAVFIDVRQSYERVSGQAEGALGIDQATLEAHSSTHLPDTNAEIVLICQSGQRSRHTGERLQA
    AGYRQLYSVAGGTDAWRKAGLPLLRPILSTDEQDFIERYARHLRLPHIGPHGQQRLAEARVLLIGAGGLGSPAAFYLTAA
    GVGHLRIADHDTVERSNLQRQILHVDAELGVPKAASAARRLSALNPRVQVEAMQVRANSSNIEALLQDVDVAIDGADNFP
    ARYLLNDACVKMGTPLVYGAVHQFEGQISVFDAGRQRGQAPCYRCLFPEPPYPEFAPS
    CSEAGVLGVLPGVIGMLQATEA
    LKLLLDIGKPLRGRVLCFDALAMQFREIRLAPDPTCPVCAPGRPFPGYIDYVAFCRNPL

    >gi|15837222|ref|NP_297910.1| c-type cytochrome biogenesis protein (copper tolerance) [Xylella fastidiosa 9a5c]
    MTFLHRLATLCVLALISFPVVAVSETDLLPVEKAFVVGVKALDRHHVLVHWKIAEGYYLYRHRIAVRVLNDGVLKSDSKL
    NLPNGYKKNDSYLGDVEIYRGSLTAVRSVLPVKGVHKLTLQVNYQGCADAGVCYPPQVRTLHVALPTGGNDLDRGAAVDR
    QDRGSAVDARPLLSEIVPGVRALPLPAEQAFGFEAIVGDGNHLLLRFTPAKGYYLYRDRTSLALEGDKTVHTGVAYWPQG
    SKYHDEHFGDVVVYFNQIEVMLPLQRDYSGPIANATLVATFQGCQIDGICYPPMTRRVRLSLPSGKVSSPNRANAIPLMG
    NHISLQNPLRSPGSNVPPGTASQSAVSVDSALENHPSYSASKFFMALSLALVGGLLLNLLPCVLPVLSLKVLALAKSGES
    RACARRHAIWYTAGVLLSFGVIGGIAIMAKILWGFQLQQPGFVGVLVYLMFAVGLSLSGVFTMSSTKFGAIGQSLMARSG
    PLGDFFAGVLACVVSSACIGPFMGPALVYAFTAPPLLAMLVFLTLGFGLALPFLLLGFVPSLTRRLPTPGPWMQTLKYVL
    ALPMYLTTIWLLWVLGKQRGVDAQSLLLVGLVMLAMGLCWFERSRWNADRWGLVLSSVLLLLTLLPLWGVTQLKIPHSIA
    QNVSSDEVAYSPLLLDRLRADNRVVFVNVTADW
    CVTCKANERNVLSSDAFHDVMHRIDAVYMKGDWTNGDAQISAFLSQH
    QAVGVPLYVVYGPGAPPNILPNVLTKDVVEDALLRAAR

    >gi|15837368|ref|NP_298056.1| hypothetical protein XF0766 [Xylella fastidiosa 9a5c]
    MSEYWYPILGGILLGLSTVMLLLLNGRIAGISGIVGRLLQGGNPAQDIPFVVGLVLGPLVFSVIFDRFPSVTVAATWPTI
    IVAGLLVGLGTRMSAG
    CTSGHGIAGIARHSPRSIVATAIFLISGMATATFMGVYQ

    >gi|15837451|ref|NP_298139.1| methionine sulfoxide reductase B [Xylella fastidiosa 9a5c]
    MNVAFDLTPPSPSQREALIATLNAEEHRILLQHGTEAPFCNRLLDNNQLGTYTCRFCGLPLFHSNAKFKSGTGWPSFFEP
    YTHAHIRKQHDTSHGMIRTEILCARCNSHLGHLFPDGPPPTYERY
    CLNSVSLTFIPTGTLLPDQLHRGDNTAYRT

    >gi|15837470|ref|NP_298158.1| dihydrolipoamide dehydrogenase [Xylella fastidiosa 9a5c]
    MTVIEIKVPDIGDYSKVPVIEVLVTVGDHVVKNQGILTLESDKATLEVPSMNNGVVKELKVNVGDLLSQGDVILLLETED
    TTAPPSPSNTATSDTTSPPPPSPQPAASKPTAPDQQHADITCRMVVLGAGPGGYTAAFRAADLGLDTVLVERYPNLGGV
    C
    LNVGCIPSKALLHAAAVIDEAAHASTFGIDFGKPKITLDTLREYKQNVVNKLTAGLAGMAKQRKVRTVTGIAHFVSPNTL
    DITTADGSTQRLHFQQCIIATGSHPVKLPNFPWDDPRIMDSTDALELAEVPKKLLVVGGGIIGLEMATVYNALGSHVTIV
    EFMDQIIPGTDKDLVKPLADRMKKQGIEIHLNTKASHVKADKKGITVSFEAPTQGTQPALKTSTYDRVLVAVGRTPTGNN
    IGAEKAGVNVTERGFIPVDRQMRSNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAAETESGKHREWVARVIPSVAYTN
    PEIAWIGMTETEAKAKSLNIGVAKFPWAASGRAIGIGRTEGFTKLIFDEDTHRIIGGAIVGVHAGDLLAEIGLAIEMGAE
    AEDISHTIHAHPTLSESIAMSAEVYDGTITDLYLPKKPATSAK

    >gi|15837513|ref|NP_298201.1| stringent starvation protein A [Xylella fastidiosa 9a5c]
    MAVNVRMRNTLTLFSSTNDVLCHRVRLVLAAKGVNYEMVSVDPQNPPEDLIDLNPYHSVPTLVERELVLYAASVVTEYVD
    ERYPHPPLMPMDPLSRARLRLAMLRIEHDWVPQVQAVQLGNKAQAEAGRKRLKELLTASLPLFKASKFFLNAEMSLADCA
    MAPIIWRLQALDVSLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDFVV

    >gi|15837563|ref|NP_298251.1| bacterioferritin comigratory protein [Xylella fastidiosa 9a5c]
    MNIGDTLNHSLLNHPLMLSGSTCKTLSDYTNQWLVLYFYPKDNTPGCSTEGLEFNLLLPQFEQINATVLGVSRDSVKSHD
    SFCAKQGFTFPLVSDSDAILCKAFDVIKEKTMYGRQVIGIERSTFLIGPTHRIVEAWRQVKVPGHAEEVLNKLKAHAEQ

    >gi|15837801|ref|NP_298489.1| thioredoxin [Xylella fastidiosa 9a5c]
    MQIITATSPDEFNAALKAHSRLLVDFYKEHCPGCRMLDMALNKFAATEAVAGVVVLKIRLETIGEDFFRDLGLRQTPTLG
    VFKNGLEVSRLLGFQSLAQIEAAVQTYL

    >gi|15837812|ref|NP_298500.1| glutathione S-transferase [Xylella fastidiosa 9a5c]
    MKLYIMPGACSLADHILLRWSGSSFDLQFLDHQSMKAPEYLALNPSGAVPALQVGDWVLTQNAAILNYITDIAPAERGLS
    GDGSLKARAEINRWIAFSNSDVHPMYWALFGGTAYLQDPQMIARSQDNARQKLRVLYQRADAHLKHHNWLANGQRSGADA
    YLYVTLRWAKKVGVDLSSLDALSAFFERMEADPGVQAALQAEGLI

    >gi|15838025|ref|NP_298713.1| chitinase [Xylella fastidiosa 9a5c]
    MYRLIVALLLGIVTLTACAQPSQPSSNKTSTTPTNATPANVQQRVTAALNTLDPDFKPDYIGAAPFPGFREVVVSGQILY
    VSDNGRYLIQAQPYDIQNKKFAVSEGLLSYRRTQLATVPQSQRIVFAPKNPQYTISVFTDIE
    CGYCRKLHSEIAELNKQG
    IAVEYLAFPRMGLGSQDYKDMVSVWCAADRKQVLTEAKAGKQIQNKNCNNPVALEYSLGQRIGVNGTPAIFAPDGTQLGG
    YLPPEKLRALLDKLAAATAKGG

    >gi|77747546|ref|NP_298725.2| disulfide oxidoreductase [Xylella fastidiosa 9a5c]
    MSLFGRLLSLLLAFVPLSICAAVNHLPVVGEDYVEIPDGRPFAPLAGKIEVVEIFGYTCPHCAHFDSKLQAWGARQAKDV
    RFTLVPAVFGGVWDPFARAYLAADVLGVAKRSHTAMFEAIHEKGSVPIQNVGPDELAVFYAGYGVQPDRFVATFNGPEVE
    KRFQAARAYALKVRPVGTPTIVVNGRYMVTGHDFEDTLRITDYLVSRERAASHGR

    >gi|15838038|ref|NP_298726.1| thiol:disulfide interchange protein [Xylella fastidiosa 9a5c]
    MKNRFAMMLMALLPVLVACQAKDGSADTVQYAIPAPSAPPSPSTATTTPTTPPPEAARPVEASRVPSGPKPVAGTDYVVI
    QDGQQFQPVVGKIEVVEVFGYV
    CPACFQFQPQIGPWKAGLASDVHFVYVPAVFGGPWDDYARAFYAAETLNLQEKTHQQL
    YKAIHVDKTLKGERGRDTVQDIANFYAKFGVNPEQFVNTMSSFGISAKVNRAKQFAKHSQVTGTPSLIINGKYLVKGRTY
    DDMLRIADHLIEGERKSLGK

    >gi|15838049|ref|NP_298737.1| thioredoxin reductase [Xylella fastidiosa 9a5c]
    MSDYPASAKHSRLLILGSGPAGWTAAVYAARANLQPVLITGLQQGGQLMTTTEVDNWPGDAHGLMGPDLMERMQAHAERF
    DTKVIFDQIYKADLSTRPFTLFGDSGLYTCDGLIIATGANAKYLGIPSEEAFKGRGVSA
    CATCDGFFYRDQDVAVIGGGN
    TAVEEALYLSNIARKVYLIHRRDKLRAEKIMQNKLFSKAATGKIELIWNNAVEEVLGNDASVTGVRIRSTQDSSTRDIDV
    QGLFVAIGHHPNTDLFAGQLAMNNGYLQIHSGTAGNVTQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDKG
    N

    >gi|15838090|ref|NP_298778.1| hypothetical protein XF1489 [Xylella fastidiosa 9a5c]
    MNEETDVMWMTRMNTVLLGSVLRIFLIAFMILIAACQVSLPDSVMPRPVDTTMHKLSVADPTQPVTSGNTPTAADIAAVA
    ALNAEFDPGRDPVADLATAKVEAKRGGKQIILSIGSKR
    CSWCRVLDEFINGDSEIRSFRDAHFIWMKVNVSDENKNEVFL
    ARFPKVKNYPHLFVLDADAKLLNSRFTADFEKGHSYDRRKFFAFLRQSVPSKN

    >gi|15838131|ref|NP_298819.1| subunit C of alkyl hydroperoxide reductase [Xylella fastidiosa 9a5c]
    MLKLYIILSSTLSATNRKYSMSVLNTEILSFKATAYKNGQFVEVSEAVLKGKWAVFVFYPADFTFVCPTELEDLADHYEE
    FQKYGVEIYSVSTDTHFSHKAWHDISPAIGKIKYAMIGDPTHEISRNFNVLRPSGLADRGTFIIDPQGVIQSVEITAEGI
    GRDAKELLRKVKAAIYVANHPGEVCPAKWEEGGKTLAPSLDLVGKI

    >gi|15838132|ref|NP_298820.1| subunit F of alkyl hydroperoxide reductase [Xylella fastidiosa 9a5c]
    MRRSFVCGDIFAVDSLYVSPSAICRAATPCAFNPPLQEIVMFDESLKAQLKAYLDRVIRSIHIHASVDESHKSREMLDLL
    ENIVLLSGKKVVLEVHRDDDQRKPSFGLGTPGESISIRFAGLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHY
    RFETYFSVS
    CQSCPDVVQALNMAAVLNPQIEHVAIDGALFQDEVEARQIMSVPTVYLNGELFGQGRMTLEQIVAKLDSGA
    AKRTAESIQAKAAFDVLVVGAGPAGTAAAVYAARKGVRTGLVAERFGGQVLDTMTIENFISVPETDGPRMVAALEQHLRQ
    YEVDIMNLQRVETLVPAGENGFIEVRLASGASLSSRTVILSTGARWRQMNVPGEDEYRNKGVAY
    CPHCDGPLFKGKRVAV
    IGGGNSGVEAAIDLAGIASYVTLLEFDTKLRADEVLQRKLRSMSNVEVIMGAQTTEVRGDGKKVTGLVYVDRSTGGSFTL
    ALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDECGHTSLPGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRNVV
    EITGIAQAQAA

    >gi|15838149|ref|NP_298837.1| dihydrolipoamide dehydrogenase [Xylella fastidiosa 9a5c]
    MTLQLNKNRKTAMSEHYDVVVIGAGPAGYHAAIRAAQLGLKVACVDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQYW
    NMGHLFNEHGISFKDAKIDVATMIARKDKIVKQFTGGIAMLFKANKITPYYGFAQLQPGNVVKVKQHEGKNIELKGANVI
    LAAGSDSVELPFATFDGETIVDNIGALDFIKVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEAMPDFLAAVDADVAKTA
    AKEFKQQGLDIKLGAKVSRTEISSKNNKKEVIVTYTDASGKQTFTVDKLLVAVGRKAATKGLLADGTGVQLNERGQIVVD
    EHCHTGVDGVWAIGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFETIPWVIYTEPEIAWVGKTEQELKANNIPYKAGS
    FPFAAVGRAVAMAEPSGFVKVLAHAETDRVLGLHLIGVNVSELVHEGVLAMEFSGSADDLARICHAHPTLSEAIHDAAMA
    VSKRAIHKAN

    >gi|15838205|ref|NP_298893.1| ABC transporter vitamin B12 uptake permease [Xylella fastidiosa 9a5c]
    MNMLNVLRFPVLALALALAFVSSGVLADAGSLLDLDYRPLAGKETVNLQRLYGGKVLLVVNTASKCGFTPQYEGLEALHQ
    KLSPLGFAVLGFPSNDFKGQEPGDEQQIQKFCTLTYGVKFPMFQKVHVKGDEVTPLYQRLTQTTGVAPGWNFHKYLIARD
    GHVVAQFDSRTRPDDPILLEAIKRELAKPVQVAH

    >gi|15838400|ref|NP_299088.1| hypothetical protein XF1800 [Xylella fastidiosa 9a5c]
    MRQSPVHFSINSCRSVNFEELQAFAGRNPILSLAFVGLAIAIVVTETALLFRRYTALKPADLTRLINSENALVVDLSPSS
    DFEKGHIAGSRSVVESKFDPESNKLLLSAKQSPLVVV
    CRNGHISAAAAKRLKNAGFEKVYWLDGGIATWKMAEMPLIKGR
    T

    >gi|15838425|ref|NP_299113.1| organic hydroperoxide resistance protein [Xylella fastidiosa 9a5c]
    MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPAE
    PRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRV
    CPYSNATRGNIDVVLILID

    >gi|15838488|ref|NP_299176.1| glutathione peroxidase-like protein [Xylella fastidiosa 9a5c]
    MHTHVSHAFASKLSLLSLDRFPMSSIYTFTFTRLDGRPQALADWRGQVLLLVNVASRCGFTPQYAGLEMLWQRYRDAGLI
    VIGFPCDQFAGQEPGDEAKIAEFCTLNYGVDFPMAAKIKVNGADAHPLWQWLKHRRRGLFGMAAIKWNFTKFLIGRNGQP
    IARYSPIKSPEQLEVHIVRALGEEGGGNTH

    >gi|15838534|ref|NP_299222.1| methionine sulfoxide reductase A [Xylella fastidiosa 9a5c]
    MVLTIEALKHLWRLDESRVGRSEPLPLDNRHYVKGHPLCDAFTGLAQIQFGLGCFWGAERLFWQLPGVFSTAAGYAGGGV
    PYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQTFWESHDPTQGMRQGNDIGTQYRSVIHCTTSKQYAAASTSREVYQ
    QQLNTAGYTAITTEILHPAPPFYYAENEHQQYLAKHPNGYCGLGGTGVTCPIRLQV

    >gi|15838584|ref|NP_299272.1| thioredoxin [Xylella fastidiosa 9a5c]
    MDYWGRWEHVLFRPLHGEWSLSMLWRYSMNLRVLGVVCAVLCVVCQGMIEASAVSVAQKVSIAGAVDPARQQPTIQRPGL
    HAKTLGGEVYDLAAHRGKWVLVNVWATW
    CEPCLKEMPELSALHRRRRDVEVVGLAYDDSKPEEIRTFLRSHPVVYPIILV
    DISNPPKNFAAPRGLPMSYLIAPDGTVAKQFLGSITARDVEGVIGAVGKAR

    >gi|15838726|ref|NP_299414.1| polyketide synthase (PKS) [Xylella fastidiosa 9a5c]
    MHILYRPSPRSGDGLPLIGLCLLTLLIFSRSVAMSSPAIVEIEIWSDVICPWCWIGKRRLERALRNSSLFAHIRVRHRAF
    RLMPELIPLPVIDVLQQRYGGSAEQIVAMQQRIENIAAEEGLMYRLVGTQGGDTLQAHRLLYLAHRQGLQEVLLERFYSA
    YFSEGTPIFDTDILAPLALDVGLERTAVAALFAGQDFIAEIEDDQRRLQRYDANGVPFFLMDGRIAVNGAQPIEAFSDAL
    AQLNADSASEPVLSLH

    >gi|15838765|ref|NP_299453.1| thioredoxin [Xylella fastidiosa 9a5c]
    MHGFYSGVCAVISCAPKLDCRVCPSSGEPLTLYRSDMSPLIHHHQLIEESLGMSDKSHVFDVTDADFETAVLKKSLETPV
    LVDFWAPW
    CAPCRSLIPILEKLVAEYRGGFELAKINVDQEQQVAAALQVRSVPMVYLVKDGQLVDGFPGAKPESQVREFL
    TKHGILPARSAAFGEDTPAIPLDPEAEVARLRQALAAEPENNDLKLDLALALLKTNVADEAAGLIDALPAKLATDDRMLR
    AKAWLRFIEVLNGVPSLDVLQAACAADASDFDQRHLLGVHLLLDGQCEVALEHFLEMLRQNRDFKDGLPRKALIDAFYLI
    EDKELVGRYRRKMSALLF

    >gi|77747598|ref|NP_299673.2| glutaredoxin-like protein [Xylella fastidiosa 9a5c]
    MSLDSALRSRIETLLHSNRVVLFMKGRPGMPQCGFSAKAAGILQALGVEYAHVNVLDDQEIREGIKRYGDWPTIPQLYID
    GELIGGSDIVSQMYENGELSALLGVAAPDLTPPSITITPTAVEMLKSTLANAPGSALALSIDSRFQPTFELTPINTQAIA
    AESNGLRVQFDLASARRAEGITIDWVDDIRGQGLVIDNPNAPQPIQELSPGDAAAQVGAGALTLVDVRPADERAIASVAV
    PFRTMDGGERAALEQLPKETPLAFL
    CHHGGRSLQAAEHFRSLGFTSIYNIGGGIDAWSIQVDASVPKY

    >gi|15839052|ref|NP_299740.1| c-type cytochrome biogenesis protein/thioredoxin [Xylella fastidiosa 9a5c]
    MSDSPRRFPTPLLLTGVMGVLILIALLTFTLMRSWDNAPDQSALLGKPAPNFSLPLLHDPSLQISNTDLAGAPYLLHVWG
    SW
    CAACATEQPVLTHFALSKRVRVIGYNWKDRREDALQWLEQLGNPYLAVVSDPEGKTAMDWGVTAAPTTFLIDGRGIVR
    WHHKGALNQQIIEHKLLPILADIEHSPTAAPALHQAP

    >gi|15839151|ref|NP_299839.1| hypothetical protein XF2562 [Xylella fastidiosa 9a5c]
    MTVTLTPVALDRVRRFIQQTPGTLGLRFGVTRTGCSGWGHFTDLACEQREGDSVFEQDGVRIFVDAHSLPLVDGTCIDFS
    KRGLSETFTFVNPNAAVECGCGESFTTDVDKA

    >gi|15839184|ref|NP_299872.1| glutaredoxin [Xylella fastidiosa 9a5c]
    MRGIGYHWTSKSTRSFLMKQDATRDEAGSTPKITIYSTAICPYCVAAKNFLKSKGYTWTEIMIDVNAAEREKMIARTQRT
    SVPQIFVGDTHVGGYDDMMALHHAGKLEPLLTNHSPQG

    >gi|15839187|ref|NP_299875.1| 6-O-methylguanine-DNA methyltransferase [Xylella fastidiosa 9a5c]
    MMSPLCYDIFDSPIGILTVVADTDALCRVMLPSNDHTTQEHKCWHYAPSTTLLKQARTQLLDYLHAELHTFSLPLRPQGT
    PFQCAVWHALAHISFGQTWSYAQLAAHIGRPSASRAVGAANARNPLPIVLP
    CHRVIGSNGALTGFNGGLHIKRSLLYLEG
    IKPTHTCKAIMTS

    >gi|15839208|ref|NP_299896.1| hypothetical protein XF2619 [Xylella fastidiosa 9a5c]
    MWPLRFNNRFIAVLPCDPEVSLRSRQVLEAWSGVAPTPVPVPCLLAYSSEVAAILNFDAEELVTPRFVEVFSGNALYPGM
    QPYAVNYGGHQFGQWVGQLGDGRVITLGELLGADGVYYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMHHLGIPT
    TRALSLIATGDTVIRDMLYDGHPAPEPSAIVCRVAPSFVRFGTFELPASRGDIDLLRRLVEFTIMRDYPHLHGAGETLYV
    DWFAEICTRTAELVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWIDNNDLDWTPNVTDAQSRRYRFGAQPQVAYWNLG
    CLARALAPLFSDAASLQAGLERFRATYLAAERRDAAAKLGFAACFDEDLELFDALRTCMHQAEMDMTLTFLGLADWEPNM
    PDSLSLWAEAFYDPVKRDAQAPMLRDWLQRYAARLSVDPLPVAERHERMRLANPRYVLRNYLTQQAIECAEQGDLIELHA
    LLEVMRRPYDFQLGREAYAMRRPEWARSRIG
    CSMLSCSS

    >gi|15839258|ref|NP_299946.1| hypothetical protein XF2669 [Xylella fastidiosa 9a5c]
    MLVMERIQAEIEEHPLVLFMKGTLEFPMCGYSSRATQALLAAGARHLHIVNVLAEAEIRANLPRFSNWPTFPQLFIHGEL
    IGGCEIILELFESGDLKRIVSEAD

    >gi|15839287|ref|NP_299975.1| thioredoxin [Xylella fastidiosa 9a5c]
    MSDYVLHVSDANFDAVVLLSDQPVLVDFWAKWCSPCKIISTLLDDLAQSYKGRLKIAKVDIDENRALAIKYHVCSIPMLL
    LFKDGQVQITQIGAVGKGRLTQMIDKVLANTDS