Xylanimonas cellulosilytica DSM 15894

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269955037|ref|YP_003324826.1| hypothetical protein Xcel_0229 [Xylanimonas cellulosilytica DSM 15894]
    MSTQTAANANLTASPVVDVFVDPLCPYAWITSRWILEVAAQRPVDLTFRLMSLYWLNEGRDLDAGYRARLDAGRGIGRVA
    AAVQTEHGPEAFAAFYTAAGTRIHPGGRADYDAVAREALAEAGLPEALADAASSDAYDEALRASHAAGMAPVGEDVGTPT
    IHVDGVGFFGPVLTRIPRGQDAVRLFDGAVALSAFPDFYELKRSRTGNPDFT

    >gi|269955101|ref|YP_003324890.1| methionine-R-sulfoxide reductase [Xylanimonas cellulosilytica DSM 15894]
    MTDYEVTKTDDQWQAELDPQEFAVLRQAATERPWTGELLDEQRVGVYRCRACGNELFRSETKFDSHCGWPSFYSPLAGDR
    VELLEDRSLGMARTEVRCARCGSHLGHVFDDAPQTPTGDRF
    CMNSVSLTFEQA

    >gi|269955247|ref|YP_003325036.1| glutaredoxin 2 [Xylanimonas cellulosilytica DSM 15894]
    MVLFTRAGCHLCDDAREVVARVCGTLGETWHEVDVDTGPESATLRDRYGDYVPVVEVDGVQQGFWQVDGDRLARRLTGRR


    >gi|269955252|ref|YP_003325041.1| Redoxin domain protein [Xylanimonas cellulosilytica DSM 15894]
    MLVAGCAQESGAGDVVDAGFVSGDGSTQQWVPDKRKEPVVVEGEDFAGAAVSTADWAGDVVVINTWYAGCAPCRAEAPDL
    VALATEREADGVRVLGINTQDDAGAAQAFERTFAVPYPSVADSSGQVIARLSGVVPLQAVPTTVVLDREHRPAARIIGQA
    DPSTLDAILDEILAEG

    >gi|269955479|ref|YP_003325268.1| glutathione peroxidase [Xylanimonas cellulosilytica DSM 15894]
    MGKEIYDIPFRRMDGTTTTLAQLAGDDRVVLVVNVASRCGLTPQYEQLETLQEKYGDRGLTVVGFPSNQFLQELGSNEAI
    AEFCSTTYGVTFPVMDRIRVNGHRTAPLYEALKKTADAGGHDGRIRWNFEKFLVLPGGTVHRYDPRTLPDAPEIIDEIES
    HLPA

    >gi|269955485|ref|YP_003325274.1| Rhodanese domain protein [Xylanimonas cellulosilytica DSM 15894]
    MTDPTDPRARVLVTVAELAADLGLDGVDPTPGPPVLLDVRWALAAAGHTFDGLAHYRAGHLPGAVFADLETELAAAPSAA
    QGRHPLPSTAQFQAAARRWGLRNDSRVVVYDATGGMSAARAWWLLRYFGLRDVRILDGGLPAWQRAGHPLEVHDVVAPPG
    DVVLSPGHLRTLDASGAAALAASEDGVLLDARAGERYRGETEPVDPRAGHIPGAVSAPTSENLTDEGSFLPTAALRDRFA
    ALGATAGTRVGVY
    CGSGVTAAHEAAALAAAGVEAILYPGSWSQWSNDASRPVATGATPV

    >gi|269955592|ref|YP_003325381.1| glutaredoxin-like protein [Xylanimonas cellulosilytica DSM 15894]
    MTDATLTMYTTTWCGYCRTLKTQLRASGIAFTEIDVEQVPDAAEFVERVNGGNRTVPTVVYPDGTAATNPSLAEVKAALA
    N

    >gi|269955712|ref|YP_003325501.1| Rhodanese domain protein [Xylanimonas cellulosilytica DSM 15894]
    MPAPFDPSPRLAEYAHPDRLVTTEWLAEQLAAGNVGTSDLVVVESDEDVLLYETGHIPGAVKIDWHTDLLQPVERDYLDG
    AGFAELLGSKGIGRDTTIVLYGDKNNWWAAYSAWVFTLFGHQDVRLLDGGRNLWVAEGRELTTDVPTPEAAEYPAVERDD
    VTYRAFKEDVLAHLGKGPLVDIRSPQEYTGERLHIPDYPEEGVLRGGHIPTARSVPWATAVAADGTYKTRAELEAIYQAG
    GLGIQADDEVITY
    CRIGERSSHTWFALHFLLGLENVRNYDGSWTEWGNAVRVPIVAGAEPGEYAA

    >gi|269955865|ref|YP_003325654.1| thioredoxin [Xylanimonas cellulosilytica DSM 15894]
    MATVELTDDTFRETVEGNDIVLVDFWATWCPPCRQFGPVFEKSSETNPDVVHGKIDTDAQQRIAAAAGITSIPTLMAFRE
    GVLVFSQPGALPAPALQQVVDAVKALDMNEVREAIEAEAAGSN

    >gi|269955867|ref|YP_003325656.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Xylanimonas cellulosilytica DSM 15894]
    MPRLAVGDVAPELALPAVGTADGSARFSLAEAVAEPGRRGVVVYFYPAAMTPGCTTEACDFRDSLASLQGAGYAVVGVSP
    DDVDKLARFAERDALTFPLVSDADHAVADAFGAWGVRKLYGKDVTGIIRSTVVVGPDGRVAVAQYNVKATGHVARLRKAL
    GID

    >gi|269955876|ref|YP_003325665.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Xylanimonas cellulosilytica DSM 15894]
    MEATSDVDVVVIGGGPVGENAADRAARTGLSVALVEAELVGGECSYWACLPSKTLLRPGAALAAAAAVPGLADQVEGMSV
    DTGAVLAWRDRTTHGWDDSGQVEWLDSVGITLVRGHGRLAGERLVEVEPPDDPSREQSGPRTLRARHAVVLATGSVPVLP
    DVPGLAAADPWSSREATGADAVPESLVIVGGGVVGTEMATAYADLGARVTLLARGGLLSGAEPFAGQAVEAELRRLGVDV
    RLGVAARSVERRAADGPVTVHHGAAAGDAGADASVTAAQLLVATGRVPRTADLGVESVGLDPGRPLTVDDTMAVVGLRDR
    SATPWLYACGDVAGRSHTTHQGKYQARVAGDVIAARFGDPAREGAPTHGDAPPDPARDPRPWSRYTASADGAAAPQVAFT
    RPQVAWVGLTEKAARKQGLSVRSVRQSLGDLAGATVTAPEYHGTAQLVIDTHRRVVVGATFVGPEAGELLHAATIAVVGQ
    VPLDRLWHAVPAYPTLSEVWLRFLEAYGW

    >gi|269956198|ref|YP_003325987.1| DSBA oxidoreductase [Xylanimonas cellulosilytica DSM 15894]
    MVDRGMNEPVHVDVWSDVQCPWCYIGKRRFEQAVATTGVDVDVTYHSFELAPDTPVDYAGTPAQFLAERKHLPMPQVEQM
    IDRVTQIAASVGLDYDYDHMHQTNTLKAHELLHYAKAHGRQAETKEALLRAYFVDGGHVGRIEDLADLAAGLGFDRDDVV
    AALQAGTYAGAVQEDVAQAAAIGIHGVPFYVIEGKYGISGAQDPATFAQVLDLVRTEKSDAPKSGDGETAADGEDAA

    >gi|269956259|ref|YP_003326048.1| UBA/THIF-type NAD/FAD binding protein [Xylanimonas cellulosilytica DSM 15894]
    MLTPLVEPGPDLATADVVRYARHLALPGVGADGQRRLAAARVLVVGAGGLGSPVLLYLAAAGVGTLGVVDDDVVDVTNLQ
    RQVVHGVGDVGRPKTTSARETVAAVNPAVRVVEHRERLGAANALALLRGYDVVVDGSDNFATRYLVSDAAELLGLPVVWG
    GLHQFQGQVSVFWAAPTDGEGVTYRDVFPEPPPPALAPD
    CATGGVLGALCGTLGSTMAAEAIKLIVGAGRPLLGRLAVHD
    ALDATWRYLVVGPDPSRPPVTALLDDAGYATFCGLPAAARPEGGDTAPTSVSAADLAAARTEPGAFVLDVREAWEAQATP
    FDSALLIPSGAFLGTDPAPATSQVAVAAGERTVYVVCRSGVRSARAASVLRAAGVDARDVVGGLDAWAREVGHPAAWRSV


    >gi|269956303|ref|YP_003326092.1| glutamate synthase, NADH/NADPH, small subunit [Xylanimonas cellulosilytica DSM 15894]
    MADPRGFLKVRDRELPPNRPVEVRLRDWKDTHAHREDGQPYLKEQAGRCMDCGIPFCHQGCPLGNLIPEWNDLVRRGQWG
    DAVDRLHATNNFPELTGRICPAPCESSCVLGISQPPVTIKNVEVSIADVAFEQGLTPQVPARLTGTTIAVIGSGPAGLAA
    AQQLTRAGHTVVVYERDPRIGGLLRYGIPDFKLEKHVIERRLEQMEAEGTRFRPGVEIGKDVTWDALRRRFDAVVVATGA
    TVPRDLRLPGRDLHGVHFAMDFLVPANRAANGEEVAADAPHAAGKHVVVIGGGDTGSDCVGTALRQGAASVTTLAIGKKP
    PLTRPAHQPWPTDPILFEVSTSHEEGGERTYLASTVDFLNDKSGAVVGLRVAETEYQPDGRRVPKPGTEHVIRADLVLIA
    MGFTGPETAALTDQTGIELTDRGLVRRGDDFATSLPGVFVAGDAGRGQSLVVWAIAEGRAVAAAVDAHLRGTTELPAPVG
    PRTVALRG

    >gi|269956488|ref|YP_003326277.1| Na+/H+ antiporter NhaA [Xylanimonas cellulosilytica DSM 15894]
    MRTEAGSAGLLVAAAVLALAWASSPWSAGYTRLWELPLVVQLDGHGLSMDLHGWVSDGLMVVFFFLIGLEVRRELAVGEL
    TDRRRIRVPLLAGVGGMVVPALLYLALNHEGEAARGWGVVIGTDTAFLLGMLALVGPAVSTQLRVFLLTLTVIDDVVAVT
    VIGVAYTDSLHAGALVAVAAALAGIVVLDRRSAWRSGPYIALVVVAWLATVYSGLHASIAGMLAGLLIPATEPQRSQVEA
    AAQQFHVFRQSPLPGLQRRTRAHLTRTISVNERFQASLHGVTSYVVVPLFAFANAGVDLRGGVLAEAMGSPVTWGVVLGL
    VVGKTLGISAGAYAATRLGLGRLPQGVGSGHVVGGAALSGIGFTVALLIVHLAFDDEALRRDAVVGVLLSVVIASVLGRV
    AFALAARYLGQRDAALPTTLSRPVDPERDHLRGPADAEVTLVEYLDFE
    CPFCARATGAARQVREHFGDRLRYVVRNLPLD
    VHPHAELAALAAEAAGRQDRYWEMHDTLFAHHDELELEDLAGYAATLGLDVEQFLRDLQEDDLADHVAQDKESAGESGAR
    STPTFFVGERRHEGPWDAATLIAALEAEASRSGRGARSRR

    >gi|269956605|ref|YP_003326394.1| UBA/THIF-type NAD/FAD binding protein [Xylanimonas cellulosilytica DSM 15894]
    MSLPPLVPVRVPLDATERRRAARHVLLDGFGPDAQARVAGARVLVVGAGGLGSPVLQYLAAAGVGTLGIVDDDVVTPSNL
    QRQVLHGADDLGERKTASAAATLRSLRPQADVVEHAVRLTADNADGLLAGYDLVVDACDTFATRYLVGDAAARRGLPVVW
    GTVLGWDGQVSVWWSAAPGGRALTYRDVFGPEPAEGES
    CETAGVLGPACGVVGTTMAVEVLKLLTGTGDPALGRLLMYDA
    RTSTWDTIPLAAPPAARGATPARETTLDAPESGVAAGRAPRVPAALGLVVDVGREAVVDGAVWVRLEDLAAGNLPPAVLD
    HPLDAPVVVVCEQGLRSRGAATVLRADGWRDVHPTTYTALASGV

    >gi|269956656|ref|YP_003326445.1| Rhodanese domain protein [Xylanimonas cellulosilytica DSM 15894]
    MLQPQSCTHPRECNCPVAHEWATPNADELGQRTELLTTAITFGADVADLFHLDLAYSPTYATTKDPVHYTGMALDGAIHG
    HAPLITPAELETRRKTGEKIQVVNVRSAKDRAKSFVADSVHLPLDQLRERSGELDPTLVTVTY
    CNKGVTGNAGQNVLRNL
    DFERVYNLSGGNQNWQAWTSA

    >gi|269956691|ref|YP_003326480.1| alkylhydroperoxidase like protein, AhpD family [Xylanimonas cellulosilytica DSM 15894]
    MARIVIKSVAPLAYVPALGLEAYAKRNVDKTTFELIKIRASALNGCGYCSAMHTRDAQRAGEAQERIAALAGDWEASGLF
    TAKESAALRYTDALTRPDGELPDALFDEVTTLWGDKGLVQLAMAIAAVNTWNRLAIGTGMTADDL

    >gi|269956757|ref|YP_003326546.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Xylanimonas cellulosilytica DSM 15894]
    MAAPDPQLENLTAPDGPQPAGAAPRIVIVGGVATGMSAAARARRLDESAEILVLERGEHVSFAGCGLPYHVGGEIASADT
    LLVHTPATLAASLNLDVRTRHDVVGLDADARTVRVRTPDGERTIAYDALVLAPGARAVRPPLPGIDSPRVRTLRTVPDAV
    TLRSWVDGAARRAVVLGAGFIGLEAAEQLAAAGLEVAVVERTDHVLPPLEGELAALVTAELDRLGIAVHDGASATAIEPG
    DGSDVVVLDDGTRLDADLVVLSVGVRPDTAVFAAAGVATDDGAIVVDEHGRTNLPHVWAGGDAVVSTDAVTGVRRPVALA
    GPANRAGRQIADAILRPATARPIPAAVGTAIVRVGRLAAGMTGANRTALAAAGIAHHTLHLHPAQHAGWFPGATQVHLLL
    HFDDGGRILGAQAVGADGVDKRLDVLATAIRGGLGVEDLIDLDLAYAPPFGAAKDPVNLAGMAAANVLDGTLRPWHAADL
    DAVLASSLVLDVRTEAELATGHLPGILHVPHTELRARLDEVRAVAAGRPVAVLCQSGVRSNLAHRILRQAGFEASSLSGG
    MLTLRATLGRTAATRLVTPATAEVEAA

    >gi|269956805|ref|YP_003326594.1| iron-sulfur cluster assembly accessory protein [Xylanimonas cellulosilytica DSM 15894]
    MTDTLETATHGVVLTDVAADKVRSLLEQEGRDDLRLRVAVQPGGCSGLIYQLYFDERLLDGDALVDFDGVGVVVDKMSVP
    YLEGAKVDFADTIEKQGFTIDNPNAGSSCACGGSFA

    >gi|269956917|ref|YP_003326706.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Xylanimonas cellulosilytica DSM 15894]
    MALQPGEPAPDFTLQDTHGTPVHLADLLADGPVLLVFFPFAFSGICTGELCELRDNIEDFETAGVRLVAVSTDPVFTLKA
    WQQVEGYTFDLLSDFWPHGAVARAYGVLDEQNGHALRGTFLIDAGGVVRWSVTNPRGQRRDLQAYRTALAEI

    >gi|269956934|ref|YP_003326723.1| Rhodanese domain protein [Xylanimonas cellulosilytica DSM 15894]
    MTSTDSADRVAHFASKLTFETDPSDVVADRAAGVRLTVVDVRSAEGYAQGHVPGALHIPLDDIADRAAAEVPIDLPVVVY
    CWGPGCNGSTHGALRFARLGYDVKEMIGGYEYWVREGLRVQTADGSQRSPIDPLTAVA

    >gi|269957017|ref|YP_003326806.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Xylanimonas cellulosilytica DSM 15894]
    MTQEHFDTIVVGAGPGGLSAAMMLGRARRRVLVLDDDLPRNRFAHHMHAVLGFDGAPPEELRRRARLELNQYDVTFAPGH
    ATEADASSDEVVVRTETGLHRGRTLINATGAADELAPIDGLADLWGRRVLH
    CPYCHGWEVRGKRLAVIATPAMGLFQAQL
    LRQWSTHLTAFVADAGTTDDATLMRMRALGTRVSTAPVTALAPRPDGAVDVCCADGSVTTVDAIFTGSVLAPRDTYLPQS
    LARLGTGFLELGSDGRTSHDRIWAVGNAAAPYANVPMSMGDGSAVGGAVNLFLVEEDLEHELRQTATPGEHGTPALSCSS
    G

    >gi|269957137|ref|YP_003326926.1| dihydrolipoamide dehydrogenase [Xylanimonas cellulosilytica DSM 15894]
    MASHYDVVLLGAGPGGYVAAIRAAQLGKSVAIIEEKYWGGVCLNVGCIPSKALLRNAELAHIFHTQKDFFGMSGEVSFDF
    GRAWDRSREVADGRTKGVHFLMKKNKITEYQGRGTFVDAKTIEVALTDGGSETVTADNVIIATGSQVRLLPGVELSDNIV
    TYETQIMTRELPKSIAIVGAGAIGMEFAYVLKNYGVDVTIIEFLDRALPNEDADVSKEIAKQYKKLGVNILTSTAVQTVK
    DNGSSVTVTFQGVKDGKAGELTVDKVLMAVGFAPNVEGYGLDKTGVALTDRGAIAIDDHMRTNVPGVYAIGDVTAKLMLA
    HVAEAQGVVAAETIAGAETMTLGDYRMMPRATFCSPQVASFGLTEAQAKDEGYDVKVASFPFMANGKAHGLGDPTGFVKI
    VADAKYNELLGAHMIGPDVSEMLPELTLAAKWDLTADEVARNVHTHPTLSEAIQEAIHGIAGHMINF

    >gi|269957223|ref|YP_003327012.1| glutaredoxin-like protein NrdH [Xylanimonas cellulosilytica DSM 15894]
    MSITVYSKPACVQCDATYRALDKKGIEYTVVDITQDAEALEMVRGLGYLQAPVVVAGETHWSGFRPDQIGALARQAATA

    >gi|269957423|ref|YP_003327212.1| peptide methionine sulfoxide reductase [Xylanimonas cellulosilytica DSM 15894]
    MSSIFDRLLGGTTQTMVAPQDALPGRSTPVLAAPGTHTVLGTPIAGPWPEGTRVLYLAMGCFWGAEEIFWQVPGVVSTAV
    GYMGGTTPNPTYEEVCTSRTGHTESALVAYDPAVVSEEELLRTFWERHDPTSGFRQGNDVGTQYRSAVYWTTPEQEAAVR
    ATADTYGAALAAAGYDPITTELRPAAEAGPFFYAEDLHQQYLSAAKHPNGYRCHATTGLPFPATA

    >gi|269957792|ref|YP_003327581.1| OsmC family protein [Xylanimonas cellulosilytica DSM 15894]
    MPIRTARTAWNGTLEQGSGQVELTSSGIATFDVSFPRRAADDAEGVTSPEELIAAAHTSCFAMQFSALIAEAGGTPEQVE
    VTADVTLAPDPAGGFHLPTIALTVVGYASGIDEATFRSVAEEAKKT
    CPISKALSGVGEVTLAVTYES

    >gi|269957807|ref|YP_003327596.1| hypothetical protein Xcel_3032 [Xylanimonas cellulosilytica DSM 15894]
    MPQLVALVALLAVTALVGGLWHARQGRIRVTAPGRGRGANESDATANLQPDTPQPGTPWAALGLTLGERATFLQLSAEVC
    SPCRATARVLTRVAATEDGVVHHELDVDQHLDLVKRLKVLTTPTVLVLDPDGVEIARASGAMSPAQAQQALALSH

    >gi|269957950|ref|YP_003327739.1| methylated-DNA/protein-cysteinemethyltransferase [Xylanimonas cellulosilytica DSM 15894]
    MTATPSVSTRSARAATVGTPDGPFTVVVGVDAVLASGWTDDVDALVALVHPSMRPESVEQRPPGSDDADALLARALDAVT
    AYYAGDLAAPAAIPVRQRSGEFREHAWDVLRGIGPGEVVTYTQYAQRSGRPAAVRAAAGACAMNAAALFVP
    CHRVLRTDG
    SLGGFRYGLPVKESLLGRERALDALF

    >gi|269957976|ref|YP_003327765.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Xylanimonas cellulosilytica DSM 15894]
    MARMVRTRVRASALTGRGWLNTGGRDLSLADLRGRVVVLDFWTFCCLNCLHVLDELRELEARYHDVLVIVGVHSPKFEHE
    ADPDALAAAVERYSVEHPVLDDPELRTWDAYTARAWPTLVVIDPEGYVVAQMAGEGHASALAALVESLVAEHEAKGTLHR
    GEGPYVPPEPTSGTLRFPAKAITLPGGTLLVADAGHHSLAELAPDGETLVRRIGSGQRGLLDGGPDEARFAEPNGLCLVP
    EDLRGRLGYDVVVADTVNHALRGVRLADGLVVTLAGTGEQFMVGGQENVTLGGRSRAYDVGEEFRADASGSVAGRVPEEL
    PASAVRLSSPWDVAWSGVAGVFLVAMAGTHTLWLFDPTAPRPGAYGTVRLLAGTMNEGLVDGVGDTCWFAQPSGLARSTR
    GAYLMGGDDVFSAADAEQLGQETFWVADAETSALRSVVVSRQPPAVVAASVLTWVGAGLFDFGHRDGDLVDARLQHPLGV
    VALPDGSVVVADTYNGALRRVETWWDDVAQQETGRVTTLATGLAEPSDVLVETGDDGGVTLLVVESAAHRLTRIALPASL
    TGEVLDGGARRTQRPATAVAAGRLRLEVPFVPAPGQKLDDRWGPSTSLQVSATPPGLLLDGAGDGTDLFRDLTVNPDVAE
    GVLHVTAKAASCDAEGEFPACHLAQQDWGVPLTVTPSGDTTLTLPLRG

    >gi|269958114|ref|YP_003327903.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Xylanimonas cellulosilytica DSM 15894]
    MNPLKIVVVGSVAAGTSVAAKARRNTETARITVYERGTEISYSGCGLPYYVGGDVEQISALTPRSPAWFKARYDVDIRTG
    HDVVAVDAGARTISVKNLATGETFEDAYDELVLATGVSPVVPPVPGVDLPGVFTVRTPSDAAAIRAWIEDRGVTRAVVVG
    AGYIGLEMAEQLAHRGLGVTVVEALDHAMARMDPDMSARVDAELRRHDVDLRLATRVTGITGTPDAATGVTVEGPDGGGP
    DGAASVDAGVVIAAVGVRPNVDLARQVGARIGQTGAIAVDRVGRTSVDHVWAVGDVAESFHLVTGQPTWVPLGSTANKTG
    RIAGDAITGGRLEHRGILGTSIVRVFDLAVAQTGLTQAQAEAAGYDVEVLHNIKPDRPEYLGGKSMVIKAVADRGTGRLL
    GAQAIGPSGVDKRIDVLATAITFGADVADLFHLDLAYSPTYATTKDPVHYTGMALDGAIHGHAPLITPAELETRRKAGEK
    IQVVDVRSAKDRAKSLVAGSVHLPLDQLRERSGELDPTLVTVTY
    CNKGVTGNAGQNVLRNLGFERVYNLSGGNQNWQAWT
    SA

    >gi|269958115|ref|YP_003327904.1| Methyltransferase type 11 [Xylanimonas cellulosilytica DSM 15894]
    MAVDETVREQVRDRYAQAAKAAATGNVAENASCCSTSATSCSEGEGGTGPTPVSFGSGLYDATNLLDLPETAVLASLGCG
    NPTAVAELRAGERVLDLGSGGGIDVLLSAKRVGATGFAYGVDMTDEMLELARANAAQAGATNVEFRKGTIEDLPFEDASI
    DVVISNCVVNLSTDKPAVLSEVFRVLAPGGRVGISDVVAEDDVAPEQRAERGSYVG
    CVAGALSKQEYLDGLAAAGFTDTD
    VTFTHEVAAGMHGAIVKAVKPTDAR

    >gi|269958136|ref|YP_003327925.1| thioredoxin reductase [Xylanimonas cellulosilytica DSM 15894]
    MTEQATPPVHDVVIVGSGPAGYTAAVYAARAGLAPVVIAGSVTAGGALMNTTEVENFPGFPEAVMGPDLMDKMREQAEKF
    GATVVWDDAERVSLSGDVKEIVTGGGETYLARAVILATGSAYRELGLEDEKRLSGRGVSW
    CATCDGFFFRDQHIAVVGGG
    DSAMEEATFLTRFASKVTVVHRRDALRASKIMAERALANPKIDFAWNSAVEAISGDAQVSGVVLRDTVTGEVRPLDVTGL
    FVAIGHEPRTELVKGQVDLDDEGYILVEGRSTRTNLPGVFACGDAVDHTYRQAITAAGSGCSAALDAQAYLTTLDDALVG
    AVAATEGVNR

    >gi|269958137|ref|YP_003327926.1| thioredoxin [Xylanimonas cellulosilytica DSM 15894]
    MTVAVTDDTFKAEVLEADLPVLVDFWAEWCGPCRMVAPILEEISEEYAGRLKVTKLDTDANPATTMAYGVVSIPTLNVYQ
    GGELVKSIVGARPKKALLAEIEPLLS

    >gi|269958222|ref|YP_003328010.1| glutaredoxin-like protein NrdH [Xylanimonas cellulosilytica DSM 15894]
    MSITVYSKPACVQCEATYRALDKKGLEYTVVDITQDATALETVRALGYLQAPVVVTEVTHWSGFRPDQINALALAQGTPT
    P