Xenorhabdus nematophila ATCC 19061 uid49133

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296491849|ref|YP_003662314.1| DsbC protein [Xenorhabdus nematophila ATCC 19061]
    MRTKLLGALMVFGIITGTAHASSKLEITDPRAAKIEDIVKLPIKGVRAVQSDGQIMFLSENGRFVISGQIYDLWSKKPLN
    TMSQMRDVAERIHFKNMGMDVDTLNTLSMGHGDKEVVVFVDPR
    CAVCHKLMDESKSLADEYTFKIVVIPALGAESNRLAK
    NLYCAEDKTHALDALMNNTLGTLSSKENCDPGQYDQTLLTAHFIGIEGVPFVVAPDGRVSKGRPKNLKSWLESAE

    >gi|296491981|ref|YP_003662448.1| hypothetical protein XNC1_p0171 [Xenorhabdus nematophila ATCC 19061]
    MTEQSTKTLRLGVIAAVFLGLVGTGFGIYQFVKEKELAQEIASVKSTVNQVKDAEGVTFKSKAEFDAAVAASINKFVEQK
    QQSDIDQKYAQFEGAPEKVEDGKHIYGDLGARFTLVEFSDLE
    CPYCKQFHDTPKQIVDASKGNVNWQWKHMPLDFHNPAA
    HKEALAAECIAEQKGNRGFWVFINDVFQRSQGNGRGVEDLASVVTGVGADLDAFRECLSSGKYEDKVQADIQKAKSYGVN
    GTPATFVVDNQTGKSQLLGGAQPAQAIMAVMRKMMIES

    >gi|300721340|ref|YP_003710611.1| soluble pyridine nucleotide transhydrogenase [Xenorhabdus nematophila ATCC 19061]
    MQYTHFDAIVIGSGPGGEGAAMGLVKQGKNVAVIERYNNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDSSRILRS
    SFSEILRHAEVVINQQTRMRQGFYERNRCRMFSGEATFIDEHRVSVRYADNSVDVLSADKIIIATGSRPYCPPDVDFTHS
    RIYNSDTILQLDHEPRHVIIYGAGVIGCEYASIFRGLGVKVDLINTRDHLLSFLDQEMSDALSYHFWNSGIIIRHNEEYE
    KIEGVDDGVIIHMKSGKKVKADCLLYANGRTGNTDTLGLENVGLETDSRGLLKVNRVYQTSNQNIYAVGDVIGYPSLASA
    AYDQGRIAAKAMTTGEADLHLVEDIPTGIYTIPEISSVGKTEQQLTAMKIPYEVGRAQFKHLARAQIAGMNVGSIKILFH
    RDTKQILGIHCFGERAAEIIHIGQAIIEQKGEGNNIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|300721424|ref|YP_003710695.1| thioredoxin 1, redox factor [Xenorhabdus nematophila ATCC 19061]
    MNEKIVNDDVVNAGIVHLSDSDFNEDKLNLKGIVLVDFWAEWCGPCKMIAPILDEIASDYAGKLTVAKLNVDDHTGTAPK
    FGIRGIPTMILFKDGEKVAVKVGALSKTQLKEFLEPHL

    >gi|300721510|ref|YP_003710785.1| peptide methionine sulfoxide reductase [Xenorhabdus nematophila ATCC 19061]
    MPNSADESQHVSLQETLADRATPITVSPYHVITQHAINTIPENMEIAYVGMGCFWGVERLFWQQEGIYTTSVGYSGGITP
    NPTYEAVCTGSTGHAEVVRIIFDPTKITYMQLLTLFWENHDPAQGMRQHGDIGTQYRSALYTVSPQQLEQALASREQFQQ
    AMIQNGDQRAITTEIREAGPFYFAEDYHQQYLYKNPEGYCGLGGMGICFPPTHRN

    >gi|300721570|ref|YP_003710845.1| hypothetical protein XNC1_0537 [Xenorhabdus nematophila ATCC 19061]
    MNYAKVSPKIINPLYKCYEEIHAAELDQALILLVETRVSQINGCAYCCHLHAEAIRKDHGIEQVKLDKLPAWFNANIYSE
    KEQLALEWAEALTTNQRQSVLDGIKSRLDTLFTEKEIVDLTAAISLMNALNRMAISLGDRSE

    >gi|300721615|ref|YP_003710890.1| adenylation of ThiS; with ThiI, thiolation of ThiS; in thiazole synthesis [Xenorhabdus nematophila ATCC 19061]
    MLNDQEFMRYSRQLLLEDIGPEGQAKLKASKVLIVGLGGLGSPAALYLAAAGVGHLYLADDDQLHISNLQRQILYRTGDI
    PANKATLAGQQLTDLNPLITVTELTERQDNESLLNAVRKADLVLDCCDNMATRHAINAACVAENKPLISGSAVGFSGQLM
    VITPPYQHGCYACLYPDQEEPQRN
    CRTAGVLGPIVGVIGTLQSLEAIKMLTGFPSSLNGKLRLFDGKQQSWSTLQLTQSS
    QCPVCRVVIRKNEAGKEVV

    >gi|300721681|ref|YP_003710956.1| Pb/Cd/Zn/Hg transporting ATPase (P-type ATPase family) [Xenorhabdus nematophila ATCC 19061]
    MFSTTKKHKQSEHHPLSSQKKAHRHTHNTAENISEHSHAPHNTNHDHSHKKAHTHEHSHDHNHDGAHCSHDHAHAIQDTT
    PLELSANQRFNWIIHGMD
    CPSCAGKIENAVKKLPEVKQVKVLFTTEKLVVDSDVDIRAAVEQAVKQAGFEIKATDAVSKL
    PPATSHWKTFSPILILTALMLISSGISQVNAPAGQIAFIITTLIGLYPVATKAIKLIRSGTPFAIETLMSVAAIGALFID
    ATAEAVMVILLFKLGEILESYAAGRARRGVSALMALVPNQAWLVKDGKKKTIPAADLRPGDIIEIAPGARLPTDAELLSP
    FASFDESALTGESIPVERQRGEKVAAGCLSVDSAVQMKVISEPGHNAIDRILQLIEEAEERRAPIERFIDRFSRIYTPLI
    ILFSALVVFIPPLFFAGSWEVWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGSLIKGGAALEQLGAVTTIALDKT
    GTLTEGKPQVTEIEPISSINAETLLALASAVESGSHHPLAKAILNVTEYKGVTIIEAEHRKALAGIGVEGQLSGKKVLVA
    APGRLPENTLSDEWKQRVIELENGGKTAVAVMQDEQFMGLIAMQDTLRQDAIDAIQILKKQGVDAVMLTGDNPRAAAAIA
    GKLGIDYRAGLLPEDKVKAVTELNKKHKTMMVGDGINDAPAMKAASIGVAMGSGTDVALETADAALTHNRLTGLPELIAL
    SRTTHYNIRQNITIALGLKAIFLVTSLLGITGLWMAVLADSGATALVTANAVRLLRAKSQK

    >gi|300721771|ref|YP_003711049.1| alkyl hydroperoxide reductase, C22 subunit, thioredoxin-like (detoxification of hydroperoxides) [Xenorhabdus nematophila ATCC 19061]
    MVLVTRQAPDFTAAAVLGNGEIVNNFNLKEHLNGRAAVIFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEF
    VHNAWRNTPISEGGIGEVKYPMVADIKHEIMQAYGIVHPEAGVALRGSFLIDKNGVVRHQVVNDLPLGRNVDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMGASPKGVADYLTKNADKL

    >gi|300721900|ref|YP_003711178.1| hypothetical protein XNC1_0889 [Xenorhabdus nematophila ATCC 19061]
    MSDDAALPLQFTDAAANKVKVLVADEDNPNLRLRVYITGGGCSGFQYGFTFDDQMNEGDLTIQKQGVELVIDPMSLQYLV
    GGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSV

    >gi|300721939|ref|YP_003711219.1| putative thioredoxin protein with protein prenylyltransferase [Xenorhabdus nematophila ATCC 19061]
    MEPTVNTNNNDAYITHIDESNVAQVVQLSLTQLVVFYFWSPQDLHCHELESTLDKIAHEYAGQFTLAKVNCGQLPHLAAQ
    FGVRGLPTVLFVQEARPVQGFEGIQTDEAIRNIFSQLLIQEGVSPLEQVNILLTEGKNQEALPLLKEMHQENPQDTDITL
    LLAQVNISLNHLEDAQKLLDTIPLEEQDEHYHELLESIKIQKAAADSPEIRQLQQELTAQPDNAELAIQLASKFHEVGRN
    EEALELLFGFLKKDLAAADGAVKKTMMDILSALGTGDALASKYRRNVYSLLY

    >gi|300721943|ref|YP_003711223.1| P-type ATPase, copper transporting, phophatase-like domain [Xenorhabdus nematophila ATCC 19061]
    MSTTTILVLQGLTCMHCVGRVKKALENIPGVEQTNVSLNYAKVISDVSSDVLIAAIVDAGYQATVAIKPDIELRLSGLNC
    MKCAGKTQTTLETVEGVIAAEVNTQTAKIYGAAEGRTLIHAVEQAGYHAELAGEDSSPKTEPLTISVSHTPESLAAATPF
    SSANASSVEESPVAAAQIKNHPIESMQIEQTKNNATDDDSIQLLLDGMT
    CASCVSKVQKALQSVDGVEHARVNLAERSAL
    VTGSASPNALIEAVIKAGYGAEIIQDETERRERQQHISHTNMRRFRWQSAFALAVGIPVMIWGMIGDNMMLTPENHMTWL
    TIGLVTLLVMIFAGGHFYRNAWQSLKNGSATMDTLIALGTGAAWLYSISVNLWPDIFPPQARHLYYEASAMIIGLINLGH
    ALEQRARQRSSKALERLLDLTPPTARVVTAEGEKPLPLADVKPNMTLRLTTGDRVPVDGEIIQGTVWLDEAMLTGEPIPR
    QKSIGDAVHAGTIVQDGTVLFKANAVGSQTTLARIIKLVRQAQSSKPEIGQLADKISSIFVPVVVAIAIISGAIWYFIGP
    APQIMYALVIMTTVLIIACPCALGLATPMSIISGVGRAAELGVLVRDADALQQASQLDTIVFDKTGTLTEGLPQVTEIHT
    FNGFTEEQVLVRAGALENGSNHPLAKALLMKVEGVKLPEVQQFRTLAGLGIQGEIEGTAVLLGNQNLLEQNQVNTTELKP
    LVAVQAEKGITPVILAIDGKIAALFSIRDPLRQDTISALQRLHHQGYHLVMLTGDNPVTANAIAKEAGIDQVIAGVLPDG
    KAAAIQSLQSKGQKVAMIGDGINDAPALAQADVGIAMGSGSDIAIETASMTLMRHSLHGVADAVELSKGTLRNMKQNLFG
    AFVYNTLGIPIAAGILYPFMGTLLNPVVAGAAMALSSITVVSNANRLLRFKPKS

    >gi|300721967|ref|YP_003711247.1| putative phosphatase [Xenorhabdus nematophila ATCC 19061]
    MESILIIANGAAYGHESLFNALRLSIALKEQEPHTELKLFLMSDAVIAGLAGQNPKEGYNLKQMLEILTAQNVNVKLCKT
    CTDARGISELALVDGVDIGTLSELAQWTLSASKVLSF

    >gi|300722082|ref|YP_003711362.1| dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, component of the 2-oxoglutarate dehydrogenase and the pyruvate d
    MSTEIKAQVVVLGAGPAGYSAAFRCADLGLDTVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAQHGIVFGEPQ
    TDIDKIRLWKEKVISQLTGGLGGMAKGRKVNVVNGIGKFTGANTLVVEGENGATTINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKTVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRVSKKFNLMLETKVTA
    VEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKSLDAGKAGVEVDERGFIHVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCSDGMTKLI
    FDKETNRVIGGAVVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLYESIGMAAEIYEGSITDLPNPKAKKKK

    >gi|300722128|ref|YP_003711411.1| protein disulfide isomerase II, activated by N-terminal of DsbD [Xenorhabdus nematophila ATCC 19061]
    MKKIAFCFSLLLTTFASNAFADESAINNSLSKMGIKAENISPSQLSDISAILTEHGIIYMSNDGKYLLQGPLYDISGSTP
    KNISNQVLVKKLDALNNQMIVYKAPKEKHVVTVFTDIT
    CGYCRKLHENMQEYNDLGITVRYLAFPRHGLQHQSAKDMQSI
    WCSATPNKSLNAVFKGEKVSPIKECKTDIAKQYQLGLQFGVQGTPAIVLKDGSVLGGYLPPKDLLATLEKQGE

    >gi|300722305|ref|YP_003711590.1| methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) (O-6-methylguanine-DNA-
    MYHHYLNTPEGFPKPYVHITADDEGVTSIYFVNEKKEPESKNSITKQCVKELQEYFKGKRLKFTVPLSMQGTEFQKRVWQ
    QLCTIPHGEMWSYKQLALTLGSVNYCRAVGMANSRNPISLIVP
    CHRVIGHDGKLVGYTGGLDIKGWLLEHEKGK

    >gi|300722445|ref|YP_003711733.1| 3-mercaptopyruvate sulfurtransferase [Xenorhabdus nematophila ATCC 19061]
    MKNEYFVSPQWLNEHLHDKNIVIVDASAPMPTQSIDYHQLWLDKHIPGAQFFDLDKVANLQTNLPHMLPEPEIFRQAVSK
    MGISENHLVVIYDQGNMFSAPRAWWTFKIFGSKHLRILEGGLQGWQTAGYPTESGEVTRSAETFNIQFTPEKVCSQTQIL
    ESLHGKTTVQFIDARAEDRFQAKTPEPRPGLRMGHLPGSKNVPWTSLIDNGSYKSTEEIAAIFRNQGVDLNQPIITS
    CGS
    GMTAAVLVLGLDMIGHQETGLYDGSWAEWGADDSLPLEK

    >gi|300722458|ref|YP_003711746.1| ATP-dependent adenylate transferase, modifies MoaD [Xenorhabdus nematophila ATCC 19061]
    MTTELTDEETLRYNRQIVLRGFDFDKQEKLKSSKILIVGAGGLGCAASQYLTAAGTGTITLLDFDTVSLSNLQRQILHHD
    DRINMPKVHSAALTLREINPHITLHPIEGLLDDPELDELINQHHIVLDCTDNIAAREQLNRLCYPRKIPLVSGAAIRMEG
    QLAVFTYQPEEPCYRCLSRLFGENNLT
    CVEAGVMAPLVGTIGCLQAMEAIKLLTQYGKVSCGKVLLFDAMTTQFREITLP
    KDPQCEVCQKL

    >gi|300722482|ref|YP_003711772.1| Arsenite methyltransferase (S-adenosyl-L-methionine:arsenic(III) methyltransferase) (Methylarsonite methyltransferase) [Xenorhabdus nematophila ATCC 19061]
    MNTKEQELSQRVGNVQYYYGTTLSSKEDLVTNVCTVDESPSDEIKAILKTVHPDVQKRFYGCGTPFPPLLTGSTVLDLGC
    GSGRDCFVLSKLVGQEGRVIGIDTTFEQIEFAKSHIEYHRDVYGYNESNVHFIHGNIESLDQLDLPSNSVDIIVSNCVIN
    LAAAKFDVLQGIFQLLKPGGEIYFADIFSDRRLSPALKNDPLLIGE
    CIGDVLYYGDFVKVARNAGFRDIRVVSSHLKTID
    NKPIEEKLGGAKLYSMTLRLFKIDLEESCEDYGQVAIYKGNLPGAPARFMLDQEHVFETGKAVPI
    CRNTADIICKSRYHS
    LFSVIGEGHTHFGIFNCGTASNSFSASNEVSMCAPSGCSW

    >gi|300722499|ref|YP_003711789.1| glutaredoxin 1 redox coenzyme for glutathione-dependent ribonucleotide reductase [Xenorhabdus nematophila ATCC 19061]
    MYTVIFGRPGCPYCVRAKELAEKLKANREDFDYRYVDIWAEGISKDDLSKTVGKPVETVPQIFIDEKHIGGCTDFEAYAK
    EHLELYTNN

    >gi|300722518|ref|YP_003711808.1| thioredoxin reductase, FAD/NAD(P)-binding [Xenorhabdus nematophila ATCC 19061]
    MSTAKHSKLIILGSGPAGYTAAVYAARANLNPVLITGVEKGGQLTTTTEVENWPGDPEGLTGPNLMERMFQHAEKFQTEI
    ISDHIKKVDFSKRPFHLYGDDQEYTCDALIIATGASARYLGLPSEDAFKGRGVSA
    CATCDGFFYRKQKVAVVGGGNTAVE
    EALYLANIASEVHLIHRRDTFRSEKILIDRLMDKVKNGNIILHTDRTLDEVLGDDMGVTGVRIRDTKSDNTEEVDVAGVF
    IAIGHSPNTGIFDGQLELEGGYLKVQSGLHGNATQTSIPGIFAAGDVMDHVYRQAITSAGTGCMAALDAERFLDGLATK

    >gi|300722618|ref|YP_003711908.1| hypothetical protein XNC1_1651 [Xenorhabdus nematophila ATCC 19061]
    MPVLHNRISNKELKERMLGETEPRTTISFYKYFTIAEPQAFRDSLYHKFTELSVFGRVYIATEGINAQISVPSKNVDVLK
    ALLDETDPAFRNLRLNIALEDDGKSFWVLRMKIRERVVADGIEDETFDPSKTGKYLKAEQVNQMLDNPDTVFVDMRNHYE
    YEVGHFENAIEIPSDTFREQLPMAVDMLKDKKDKNIVMY
    CTGGIRCEKASAYMLHNGFNKVYHVEGGIIEYARKAKEQGL
    PVRFIGKNFVFDERMGERISEEIIAHCHQCGASCDSHTNCKNDGCHLLFIQCSSCAERFEGCCSDGCCEEMKLPEEEQRA
    RRAGRENGAKIFNKSRYRINDSLNITSLQSMK

    >gi|300722830|ref|YP_003712122.1| putative monothiol glutaredoxin ydhD [Xenorhabdus nematophila ATCC 19061]
    MTTTNMNTNTVADTTTHEIIEKIKRQISENPILLYMKGSPKLPSCGFSAQAVQAISACGERFAYVDILQNPDIRAELPKY
    AHWPTFPQLWVDGELVGGCDILVEMYQRGELQTLIKETADKYREQE

    >gi|300723255|ref|YP_003712555.1| putative oxidoreductase, inner membrane protein [Xenorhabdus nematophila ATCC 19061]
    MTEYLLLFIGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASISSWLINTFILVPLDLIYLRTLSFILV
    IAVVVQFTELVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNQSHGFLQSAVYGFSAAAGFSLVMVLFAAIRERLAV
    ANIPSPFRGSSIGLITAGLMSLAFMGFSGLVKF

    >gi|300723260|ref|YP_003712560.1| putative NADH-quinone reductase, membrane protein [Xenorhabdus nematophila ATCC 19061]
    MSETKNLFIQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLLSTNIAVSALRRWVPHEIRIPIYVMIIASVV
    SAVQMLINAFAFGLYESLGIFIPLIVTN
    CIVIGRAEAYASKNSIYNSMIDGLAMGFGATFALFVLGAIREILGNGTLFDG
    ADLLLGSWAKSLRIEIVHMDSPFLLAILPPGAFIGLGLMLAGKYIIDERLKNRSENKERQYNVEKDNVEKGCGSHITRS

    >gi|300723415|ref|YP_003712718.1| selenophosphate synthase [Xenorhabdus nematophila ATCC 19061]
    MSTEIRLTQYSHGAECGCKISPKVLETILHSEQEKFFDPNLLVGNETRDDAAVYNIGNGTGIISTTDFFMPIVDDPFDFG
    RIAATNAISDIYAMGGKPIMAIAILGWPIAKLSPEIAQKVIEGGRAVCKEAGISLAGGHSIDAPEPIFGLAVTGIIDIEH
    VKRNNQAEAGSLLFLTKPLGVGVLTTAEKKGLLQREHQGVAKEVMCQLNQSGTDFAKIAGVTAMTDVTGFGLLGHLSEVC
    EGLGMQAIVKFSQIPRLPDVDIYIEKGCVPGGTGRNFDSYGHLIGKMTARQRHLLCDPQTSGGLLLAILPEAVEEAKAIA
    RNHDIDLVVIGELTEPCLDRALIEVIE

    >gi|300723425|ref|YP_003712729.1| methionine sulfoxide reductase [Xenorhabdus nematophila ATCC 19061]
    MTKSQNISLFIKQLNAMQRHVTQEAGTEPPFSGKLLHNKKSGIYHCLCCRQPLFVSETKFDSGCGWPSFYQPVNDASITY
    IDDNSHNMHRIEVRCSHCQAHLGHVFPDGPKPTGERF
    CINSASLRFVDKETGEETAG

    >gi|300723459|ref|YP_003712764.1| disulfide bond formation proteins (oxidoreductase) with quinone as electron acceptor, reoxidizes DsbA [Xenorhabdus nematophila ATCC 19061]
    MFQSLKQRSQGRGAWLLMALTALILEATALYFQHAMQLQPCVMCIYERVALFGILGAALLGAVAPKTPLRWLAILLWVYS
    AWQGLRLAWDHTMMQLYPSPFNT
    CEFFVNFPSWLPLNDWLPSVFQAYGDCSMKQWEFLTLDMPQWLIGIFAAYLVVAVLV
    LVSQVVWIQQR

    >gi|300723493|ref|YP_003712798.1| bifunctional: transcriptional regulator of DNA repair (AraC/Xyl family) (N-terminal); O6-methylguanine-DNA methyltra
    MSWKTDDERWQAIIERNKDADNHFVYAVRTTGIYCLPSSTARLPKRANVIFFDTEKEAEQHGYRPNKRLRRNNQSEPEKN
    YLIKIAKACRYIEQNEGPITLKKLANYVGISTFHFHRLFKAKTGLTPKACANAHRSQRLRNNLEQTQSVTEAILEAGFNS
    SSRFYEISSDLLGMTPKIWRAGGKGMQIYFALGIYSLGHILVAQSEKGICAILLGDDPNKLLQELQNKFSHAEFIGGNPQ
    FEQLIAQVVGFVEKPETELKLPLDIRGTVFQQRVWLALRDIPVGTTVSYAEIAERIGSPKAVRAVASACAANMLAVAIP
    C
    HRVVRNDGALSGYRWGVERKRELLTREAKRDE

    >gi|300723513|ref|YP_003712818.1| thiol peroxidase [Xenorhabdus nematophila ATCC 19061]
    MTQTVKFQGSDITVNGDFPQAGQKAKAFTLVAKDLADVTLSQYAGKRKVLNIFPSIDTGVCATSVRKFNQLASELDNTIV
    LCISADLPFAQSRFCGSEGLSNVVTLSTLRGGEFLENYGVAISEGPLSGLTARAVIVLDENDQVIYSQLVGEITDEPNYD
    NALSALK

    >gi|300723548|ref|YP_003712853.1| Protein yffB [Xenorhabdus nematophila ATCC 19061]
    MSDTTSHKAITLYGIKNCDTIKKARRWLEDQEIPYQFHDYRVDGLSPELLQSFIEQTGWESLLNTRGTTWRQLSDEQKAA
    INNAEAAKVLMLEKPAIIKRPLLISVTEGTKASASAIEKYLLGFRTEQYQQFFSHE

    >gi|300723561|ref|YP_003712866.1| thiol peroxidase, thioredoxin-dependent [Xenorhabdus nematophila ATCC 19061]
    MSPLKAGVKAPQFSLPDQDGETINLSDFKGQRVLVYFYPKAMTPGCTVQACGLRDTMNELKSLNVEVLGMSTDTPEKLSR
    FAEKEMLNFTLLSDVDHKIAEQFGVWGKKQFMGKTYDGIHRISFLINPQGNIEHVFDKFKTSEHHQVVLDYLKQH

    >gi|300723564|ref|YP_003712869.1| putative arsenate reductase with thioredoxin-like domain [Xenorhabdus nematophila ATCC 19061]
    MQQVTFYHNPRCSKSRESLKMVEDLGITPEIIHYLDTPPTAEELALLLKQLGFNDARQLMRTKEDLYKELNLADKALSQE
    TLLKAMAENPKLIERPIVVAGNQARLGRPPEQVKEILG

    >gi|300723894|ref|YP_003713205.1| putative oxidoreductase, inner membrane protein [Xenorhabdus nematophila ATCC 19061]
    MEHYISLFVRAVFIENMALSFFLGMCTFLAVSKNVKTAFGLGVAVTVVLGISVPANNLVYNLVLRDGALMDGVDLSFLNF
    ITFIGVIAALVQILEMILDRYVPALYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFSESIVYGFGSGMGWMLAIVLMAAI
    REKLKYADVPAGLKGLGITFVTTGLMALGFMSFSGVQL

    >gi|300723895|ref|YP_003713206.1| putative NADH-quinone reductase, membrane protein [Xenorhabdus nematophila ATCC 19061]
    MADSKEIKRVLLGPLFDNNPIALQVLGVCSALAVTTKLETALVMTIAVTLVTAFSNFFISLIRNYIPGSVRIIVQMAIIA
    SLVIVVDQILQAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPVESFMDGIGNGLGYGVILVLVGFLRELFGSGKL
    FGITVLESVKNGGWYQPNGLFLLAPSAFFIIGMLIWGLRTLKPAQVEKE

    >gi|300724153|ref|YP_003713470.1| putative regulator believed to be involved in Fe-S cluster assembly and activation [Xenorhabdus nematophila ATCC 19061]
    MSISLTESAAQRIVAFLDNRGKGVGLRLGVRTSGCSGMAYVLEFADVVNEEDQVFEDKGVKVIVDGKSILYLDGTELDFV
    KEGLNEGFKFNNPNVSSECGCGESFHV

    >gi|300724417|ref|YP_003713737.1| thiol:disulfide interchange protein, cytochrome c-type biogenesis, electron carrier, N-terminal interacts with and a
    MMKRILMLFLLFSSIALAPGKASALFEQPGKSLYLPAAQAFMFDFQQKENQLTLSWDIKPGYYLYRKQFSIIPKQASLGN
    PVYAEGIEHEDEFFGKTEVYFQSARIDIPILSATHDASLQVTYQGCAEAGYCYPPETLTVPLQAVVASTLLNNNETAISS
    EIVTPEERLSSKPPLQQADSQSQEHDVPFSPLWAFLIGIGIAFTPCILPMYPLISSIILGQKRPENLTRIFWLAVSYVQG
    MALTYTILGLVVAAAGLQFQAALQSPYILVGLSVLFILLALSMFGLYTLQLPSSVQTRLVDWSNQQKSGSYIGVFIMGAL
    AGLIASPCTTAPLSAILLYIAQSGNTLIGGLTLYLYALGMGLPLIAVTLFGHKLLPRSGPWMQYVKEGFGFIILALPVFL
    LERVLGDVWSIRLWSMLAAAFLIWAFALTLNSKNGWLRTLQIVLLALALIATRPLQDWIWGNSPTEQQKTVINFQQVNDW
    QELNQILAENRHKPIMLDLYADW
    CVACKEFEKYTFSDPQVQAQLNQFLTLQANVTDNGPKQKELLQRLNVLGLPTILFFD
    TQGNELSDARVNGFMNAERFNQHIQQIQQK

    >gi|300724698|ref|YP_003714023.1| nitrite reductase, large subunit, nucleotide-binding [Xenorhabdus nematophila ATCC 19061]
    MSTLRLCIIGNGMVGHRFIEDLMDKVRHEQIEMTVFCAEPHIAYDRVHLSSYFSHHNAEELSLVREGYYEKHNIRILRGE
    QATLINRDTKTVHSDNGRIVEYDTLIIATGSFPWIPSIKGHDGTDCFVYRTLEDLNAIEACAKRSRRGAVIGGGLLGLEA
    AGALKKLGIETHVIEFAPVLMAEQLDSMGGEQLRKKIERMGVNVHTNKNTLEIIHSGHSYNKTMQFADGEALEVDFIVFS
    TGIRPQDKLARECGLSIAQRGGIVINDYCQTSDKDIYAIGECASWQEKVYGLVAPGYKMAQVAADHILKRENAFHGADLS
    AKLKLLGVDVGGIGDAHGHQPDGRSYIYLNENKGIYKKLVVSEDNKYLLGAVLVGDTADYGNLLQMMLNHIELPDNPYAL
    ILPAHIGGGKPLLGTDALPDSAQLCSCFDVSKGNIIQAVQKGCHTVAAIKAETKAGSGCGGCVPLISQVLNAELSHQGIE
    ASHHLCEHFAYSRQELYHLIKIDRLTSFRQLVEKHGKGYGCEICKPTVASLLASCWNDYVLSDDLVSLQDTNDNFLANIQ
    KDGTYSVIPRSPGGEITPDGLIVVGNIAKEFHLYTKITGSQRIAMFGAQKNDLPLIWQRLIDAGFETGHAYAKALRMVKT
    CVGSTWCRFGVGDSVGLGVELENRYKGVRAPHKMKFGVSGCTRECSEAQGKDVGIIATSKGWNLYVCGNGGMKPRHADLL
    AADLDKATLIHYIDRFMMFYIRTADKLQRTSVWLENMEGGIEYLRAVIIDDKLGLNKQLEQDMTELRAKTVCEWQQTVSD
    PHAQIRFSHFINSAERDPNIQMIAERAQHRPALPQERIAIKLIKSEEETA

    >gi|300725079|ref|YP_003714407.1| glutathione oxidoreductase, nucleotide-binding [Xenorhabdus nematophila ATCC 19061]
    MSKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKVLGGTCVNVGCVPKKVMWHAAQIAESIHQYGADYGFDTTVNRFD
    WKKLIASRTAYIDRIHQSYERVLGNNNVDVIQGFARFIDAHTVEVNGEKITADHILIATGGRPAHPEIPGAEYGIDSDGF
    FELDEMPKRVAVVGAGYIAVEIAGVLNALGSETHLFVRKHAPLRSFDPLIVDTLLEVIKNEGPTLHTEAILKSVIKNSDG
    SLTVQLQDGREQTVDVLIWAVGREPKTDSLNLSAAGVKLNEKGYIQVDKYQNTNVNGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPEEHLDYADIPTVVFSHPPIGVVGLTEPQAKAQYGDDQVKVYTSSFTAMYTAVTQHRQPCRMKLVCAGANE
    KIVGIHGIGFGMDEILQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMRS

    >gi|300725094|ref|YP_003714422.1| periplasmic protein disulfide isomerase I, disulfide bond formation [Xenorhabdus nematophila ATCC 19061]
    MKKFWLALVGTLMAFNVSAAGFSEGKQYVDLKDPVANQPQVVEFFSFYCPHCYQFENVYHVPATVEKNLPAGVTHERYHV
    SFLGPLGDALTDAWAVAIVMKIEDKVTPILFDGIQKTRTINSKDDIRNAFIKAGVTGEDYDAALNSFIVQSVAAKERQAA
    KDFALRGVPAVFVNGKYQVNNGGIEAASALEYGKGFSDVVNYLLTKK

    >gi|300725232|ref|YP_003714560.1| thiosulfate:cyanide sulfurtransferase (rhodanese) [Xenorhabdus nematophila ATCC 19061]
    MDHFQTINPDQAYQYWLEKTAVMVDIRDPQSFRTGHVTDAFHLTNETLNNFLQEADFDRPVMVMCYHGHSSQGAAQYLIN
    MGFETVYSVNGGFDVWQKNYPQAVRTL

    >gi|300725237|ref|YP_003714565.1| hypothetical protein XNC1_4479 [Xenorhabdus nematophila ATCC 19061]
    MSKELFTATVESVGTLKMKCSSRDFSFHLDEPERLGGKNEAMTPVEALLSAFGACQSMVAKSFAKAHKINLIDIKIKLEG
    ELDLDGLKGINKNAKIGFSKITSKFYIKADNTEQEIQDFVDFVERNCPILDTIVNTPDIVTEIYIEK