Bacteroides fragilis NCTC 9343 uid57639

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|60679620|ref|YP_209764.1| putative dihydrolipoamide dehydrogenase [Bacteroides fragilis NCTC 9343]
    MKYQVIIIGGGPAGYTAAEAAGKAGLSVLLFEKQNLGGVCLNEGCIPTKTLLYSAKTYDGAKHASKYAVTVPEVFFDLPK
    IIARKSKVVRKLVLGVKSKLTSNNVTIISGEATILDKNTVRCGEETYECDNLILCTGSETFIPPIPGIDSVNYWTHREAL
    DNKELPASLAIVGGGVIGMEFASFFNSLGVKVTVIEMMDEILGGMDKELSALLRADYAKRGIQFLLSTKVVSLAQTEEGA
    VVSYENAEGAGSVIAEKLLMSVGRRPVTKGFGLENLNLQRTERGSIVVNGQMESSLPGVYVCGDLTGFSLLAHTAVREAE
    VAVHAILGKEDRMSYAAIPGVVYTNPEIAGVGQTEESLTAKGIAYRAVKLPMAYSGRFVAENEGVNGVCKVLLGEDDTIL
    GAHVLGNPASEIITLAGMAVEMKLKAAEWKKIVFPHPTVAEIFREAL

    >gi|60679642|ref|YP_209786.1| lipoprotein [Bacteroides fragilis NCTC 9343]
    MKNLILVLGCFFFLISCQQTEKEKLEELVKNWNGKEVLFPTNPSFTLYGKTPVDFKIPVSDYKIVTYVDSLGCSSCKLQL
    PKWKEFMKYADSIVGYQIPVLFFLHPANVREMRSVLKQNRFDYPVCMDTEDTFNKVNKFPSQLNFQTFLLDKNNHVIAIG
    NPVHNYDVRELYIHLISGGIDGDSLSNMRTVIKIEEDMVDLGSFDWRREQHITFEIHNIGNNNLVVYDNKTS
    CGCTSVEY
    SKEPVQPGKSLAVKVTYKADHPEHFNKTIILYCNASASPLELKITGNAK

    >gi|60679655|ref|YP_209799.1| putative lipoprotein [Bacteroides fragilis NCTC 9343]
    MKSGLICCLMLCILLVGCEGKKVKGIKNMVDSWMGREILFPNSVSCMALKESNLGLIERRTDYTIVSYIDSSGCTACKMQ
    LRKWMEVINCFDSLNTNVKFLFYLHPKEPKEITYLLKRDGFEYPVFVDRLDSFNILNHFSTDINFCTFLLDKTNRVIAIG
    NPLYSKKVKDLYKGIVLKRKEVTVSGILQTETTLPKSSIDMGSFSSEKSQSCIFTLYNIGKNMLVIDDAVTS
    CGCTSVEY
    SKEPVSPGKSLDIIVTYKADHPEHFNKTITVYCNSSVSPLRLKIMGNAK

    >gi|60679986|ref|YP_210130.1| hypothetical protein BF0403 [Bacteroides fragilis NCTC 9343]
    MGRPIKIIGYLCFLMALCSCKETKEQQISRLIHEWEGRTIVYPADMTFSVLGKDSAGYSFPQNEYTIMTYVDSVGCTSCK
    LQLPTWKYFISMVDTMANGKVSFLFAFHPKNKKEISFLLKRDRFLYPVFIDEKGGFDALNHFPSDVNFQTFLLDSQNKVI
    AIGNPVHNKKVRDLYLQIITGRQTGVATSSQTKVVLDKNLDEMGDFDWKTPQTATFSLRNLGDHLLIIEDINAS
    CGCTSV
    AYSKEPVSPRKSADIQVTYRAEHPEHFEKTITVYCNTPTSPIRLKIRGNAIDEEY

    >gi|60680016|ref|YP_210160.1| hypothetical protein BF0438 [Bacteroides fragilis NCTC 9343]
    MSKMNSMLMGICFLLSSLFSCQQSKGNFKTVPVKEFASLIEDASVQRLDVRTMAEYSEGHIPGTININVLDDSFAVMADS
    TLQKDKPVALY
    CRSGKRSKKAAAILSEKGYKVYELDKGFNAWQEAGEKVEK

    >gi|60680094|ref|YP_210238.1| putative pyridine nucleotide oxidoreductase [Bacteroides fragilis NCTC 9343]
    MKIIIIGGVAGGATTAARIRRSDETAEIILLEKGKYISYANCGLPYYIGDVIEEREKLFVQTPEAFGVRFRVDVRTENEV
    IFIDRKKKTVTVRLKSEDTYEESYDKLLISTGASPVRPPLPGIDSTGIFTLRNVADTDRIKAYVNNRPPRRAVVIGAGFI
    GLEMAENLHALGAQVSIVEMGNQVMAPIDFSMAALVHQHLMEKGVNLYLEQAVASFEQAGKEVKVVFKNGQSILADIVIL
    SIGVRPETTLARAAELTIGEAGGIAVNDYLQTSDESIYAIGDAIEFRHPITGKPWLNYLAGPANRQGRIVADNLLGAQIP
    YEGAIGTSIAKVFDMTVASTGLPGKRLKQAGIVYASSTTHPASHAGYYPDAMPMSIKITFDPQTGKLYGGQIVGYDGVDK
    RIDELSLVIKHEGTIYDLMKVEQAYAPPFSSAKDPVAIAGYVAENIILGRVKPVYWRDLRDIELKDVFLLDVRTPDEFAL
    GSLPGAVNIPLDEIRDRIAELPSNKPIYTF
    CAVGLRGYLVYRILIQHGFKEVYNLSGGLKTYRAATAPIILHENEETDDT
    PSAQDSPAEPSVAAEAPQTTTAANPKTIRVDACGLQCPGPVLKMKKTMDTLVPGERVEIVATDPGFSRDAAAWCNSTGNK
    FISKDSTGGKSVVVIEKGEPQACNLTTTCDSKGKTLIMFSDDLDKALATFVLANGAAATGQKVTIFFTFWGLNVIKKLHK
    PKVEKDIFGKMFGTMLPSSSLKLKLSKMSMGGMGGKMMRYIMHRKGIDSLESLRQQALENGVEFIACQMSMDVMGVKREE
    LLDEVTVGGVATYMERADNANINLFI

    >gi|60680203|ref|YP_210347.1| putative thioredoxin [Bacteroides fragilis NCTC 9343]
    MALEITDNNFKEILAEGSPVVIDFWAPWCGPCKMVGPIIDELAKEYEGKVIMGKCDVDENSDLPAEFGIRNIPTVLFFKN
    GELVDKQVGAVGKPAFVEKVEKLL

    >gi|60680275|ref|YP_210419.1| oxidoreductase [Bacteroides fragilis NCTC 9343]
    MGKLGILSLMFCTIVLLSCGKKNNVYPELEAFIGKEIIFSDKNFNTVGNKAFKDQFLLISYVDSGNCTPCSLEKMQYMKT
    NKRRLLDTHTGVLMIVHEKDTFTVNEVFRQMHVSYPIFFDSLGCFKKENGIFDNPLYQDFVIDRSNKVVWLGNPLRNKQS
    WQQYEKAISMLMDSGK

    >gi|60680276|ref|YP_210420.1| hypothetical protein BF0717 [Bacteroides fragilis NCTC 9343]
    MYSKQLIIIKQRRMKRSLLFIFTLLTITLSAVAQPRISSNKETHHFGQIEWKRPVSVEYTITNTGDKPLVLTNVTTSCAC
    SVANWTKTPIAPGEKGTVSATFDAKALGHFNKSIGIYSNAQPSLVYLNFDGEVVQEIKDFTKTHPYAIGQIRIDRTDIDF
    PDAHSGEKPVITLGVVNLSDRPYEPVLMHLPPYLKMETNPTVLLKGKKGTITLTLDTKQLMDLGLTQSSVYLARFAGDKV
    GEENEIPVSAVLLPDFSGMTEQDKAVAPVIRLSESKIDLSQVLAKKNKARRDIVITNTGKSPLQISKLQVFNPAVGVALK
    KTVLQPGESTRLRVTVLKKNLGKKKRHLRILMITNDPVQPKVEIDVKATNNESHN

    >gi|60680500|ref|YP_210644.1| putative thioredoxin reductase [Bacteroides fragilis NCTC 9343]
    METERIKCLIIGSGPAGYTAAIYAGRANLSPVLYEGIQPGGQLTTTTDVENFPGYPQGISGPQLMEDLRTQAERFGADIR
    FGIATASDLGQAPYKITIDGEKVIEADSLIIATGATAKYLGLDDEKKYAGMGVSA
    CATCDGFFYRKKVVAVVGGGDTACE
    EAIYLAGLASKVYLVVRKPYLRASKIMQERVRKHDKIEVLFEHNVVGLFGENGVEGMNLVKRWEEPDEERYSLPIDGFFL
    AIGHKPNSDIFKPYLDTDEVGYITTDGDSPRTKVPGVFAAGDVADPHYRQAITAAGSGCKAAIEAERYLSEKGLI

    >gi|60680706|ref|YP_210850.1| putative bacterioferritin comigratory protein [Bacteroides fragilis NCTC 9343]
    MNVGDKAPELLGINEKGEEVRLNNYKGRKIVLYFYPKDNTSGCTAQACSLRDNYAELRKAGYEVIGVSVDNEKSHQKFIE
    KNNLPFTLIADTDKKLVEQFGVWGEKKLYGRAYMGTLRTTFLINEEGVIERIIGPKEVKAKEHASQIL

    >gi|60680732|ref|YP_210876.1| alkyl hydroperoxide reductase subunit F [Bacteroides fragilis NCTC 9343]
    MLDSAIKEQLRTIFAALEANYTFDITVSPQHESRTELLELLNDVASCSEKLSCRINEGKGLEFTLLKGEHRTGITFRAVP
    NGHEFSSLLLAILNTDGKGKNFPDEGICNRVKSLKGPVRLTTYVSLT
    CTNCPDVVQALNAMTTLNGQIQHQTVDGAINQA
    EVEALKIQGVPSVFADGKLIHVGRGDFGELLAKLEEQYGTETNSAETSIKKYDVIVAGGGPAGSAAAIYSARKGLNVAVI
    AERIGGQVKETVGIENLISVPSTTGSQLADNLKTHMSQYPIDLLEHRQIEKIELDGKDKVLTAKGGERFSAPAVIVATGA
    SWRKLNVPGEAEYIGRGVAF
    CPHCDGPFYKGKQVAVVGGGNSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKLKSLP
    NVEVLVHSQTTEVVGNGDKVTGIRVKDRKTEEERVISLDGIFVQIGLVANSGIFRDVVEVNRPGEIVIDAHCRTNVPGIY
    AAGDVSTVPYKQIIIAMGEGAKAALAAFEDRMRGEI

    >gi|60680733|ref|YP_210877.1| alkyl hydroperoxide reductase C subunit [Bacteroides fragilis NCTC 9343]
    MEPIINSQMPEFKVQAFQNGSFKTVSSEDVKGKWAIFFFYPADFTFVCPTELVDVAEKYEQFQAMGVEVYSVSTDSHFVH
    KAWHDASESIRKIKYPMLADPTGVLSRGFGVMIEEDGMAYRGTFLVNPEGKIKIAEIQDNNIGRNADELLRKVEAAQFVA
    THDGEVCPAKWKKGEATLKPSIDLVGKI

    >gi|60680797|ref|YP_210941.1| putative thioredoxin [Bacteroides fragilis NCTC 9343]
    MEEKKEARQKRNREKLATADWVMAEFYATWCPHCKRMQPVVEEFKKLMEGTLEVVQIDIDQEDALANFYTIESVPTFILM
    RKGEQLWRQSGELDLERLKKAVKDFKS

    >gi|60680884|ref|YP_211028.1| putative LPS biosynthesis related UDP-galactopyranose mutase [Bacteroides fragilis NCTC 9343]
    MKKKYDYLIVGAGLYGSVFAYKAQRNGKKCLLIDKRPHNGGNIYCENIEGINVHKYGAHIFHTSNKEVWDFVNAIVEFNR
    YTNSPIANYKGKLYNLPFNMNTFYALWGTKTPEEAKMKIEEQRREAGILTPKNLEEQAISLVGKDIYEILIKGYTEKQWG
    RKATELPAFIIKRLPVRFTFDNNYFNDKYQGIPVGGYNKLINGLLDGIEVRTNTDFFQNKEYFKGLADKILFTGKIDEYY
    NYQFGRLEYRTVEFETQVLDCENYQGNAVVNYTEREVPYTRIIEHKHFEFGTQPKTVISKEYSSEWKDGSEPFYPVNDER
    NNSLYLEYKKLVDREKNVLFGGRLAEYKYYDMNVIVEKVINSDL

    >gi|60680892|ref|YP_211036.1| hypothetical protein BF1378 [Bacteroides fragilis NCTC 9343]
    MKKNFFYAGGLSLLLWGMAACSGQGKADKAAVVADSVVVKTDSVAADSTGYIVKVGESAPDFTITLTDGKQMKLSELRGK
    VVMLQFTASW
    CGVCRKEMPFIEKDIWLKHKNNPEFALIGIDRDEPLDKVIAFGKSVGVTYPLGLDPGADIFAKYALRESG
    ITRNVLIDREGKIVKLTRLYNEEEFASLVDQIDEMLKK

    >gi|60680933|ref|YP_211077.1| putative pyridine nucleotide-disulfide oxidoreductase [Bacteroides fragilis NCTC 9343]
    MKQYDAIIIGFGKGGKTLTAELAKRGWKVALIERSAMMYGGTCPNIACVPTKRLIHEAEKVSWLYPTDYEKQAEAYKAAI
    ARKNEMTAASRGNMFNKLSSLPNVTIYTGMASFVSKDVVKVTLPDEVIELQGKKIFINTGSTSIIPAIDGLKDSKRVYTS
    TSLMELDVLPRHLIIVGGGYIGLEFASMYASFGSKVTVLEGGNKFIAREDRDIADAVKETLEKKGIEIRLNARAQSIQDT
    ADGVTLTYTDTADGKPVTIEGDAILVATGRKPMTEGLNLQAAGVEVDSHGAIVVNGYLHTTAPNIWAMGDVKGGLQFTYI
    SLDDYRIIRDDLFGNKERTADDRNPVAYSVFIDPPLSHVGLTEEEAIKRGYSFKVSRLPASALPRARTLQQTDGILKAIV
    DSHSGRIMGCTLFCAESSEVINVVNMAMKTGQHYTFLRDFIFTHPSMGEGLNDLFSID

    >gi|60681127|ref|YP_211271.1| putative dihydrolipoamide dehydrogenase [Bacteroides fragilis NCTC 9343]
    MRYDIAIIGGGPAGYTAAERAGANGLRAVLFEKKAMGGVCLNEGCIPTKALLYSAKVLDGIKSAPKYGVSVEGAPAFDME
    KIIGRKNKTVQKLTGGVRMTVNSYGVTIVDKEAVIEGEGEEGFHIRCDGEVYEATYLLV
    CTGSDTVIPPIKGLSDVDYWT
    SREALDSTVLPSSLAIIGGGVIGMEFASFFNSMGVRVKVIEMMPEILGAMDKETSAMLRADYTKKGVNFYLNTKVTEVSD
    KGVTVEKDGKSSFIDADRILVSVGRKANITQVGLDKLNIELHRNGVVVDEHMLTSHPRVYACGDITGFSLLAHTAIREAE
    VAINHILGIDDRMDYDCVPGVVYTNPELAGVGKTEEELIAKGIYYRIQKLPMVYSGRFVAENELGNGLCKLIIDHNDRIV
    GCHMLGNPASEIIVVAGIAIQRGYTVDEFRKSVFPHPTVGEIYHETLFA

    >gi|60681151|ref|YP_211295.1| putative ferredoxin [Bacteroides fragilis NCTC 9343]
    MAKIKGAIVVDTERCKGCNLCVVACPLNVISLAKEVNVKGYNYAQQILEDTCNGCSSCATVCPDGCISVYKVKVE

    >gi|60681361|ref|YP_211505.1| hypothetical protein BF1870 [Bacteroides fragilis NCTC 9343]
    MNAKKNLMAFILTVSSIALMVICLGLGMVKACAGGDGSEWKEKVAADTLHVVHYTRPDLPQIMTDPAERAVYYVKHYWDG
    YLTGDTAWVNSGDTEQLYVDFIDALKYVEPETGRKALHTMMVRMEADSTAYRRFCLLGEKYLNEPNSPMRNEDFYIAVLE
    QMLQSDRLQEWEKIRPADRLKQAHKNRPGMKAADFTYVTVHGDNSRMSRLKAQYTMLFFYDPD
    CSNCRKFEKLFAEIPAF
    VEMVENGTLRVLAIYPDENREEWATKAVYMPQGWIVGWNKAGDIRTRQLYDIRATPTIYLLDGRKRVILKDTSMEQLIDY
    LATQAGK

    >gi|60681552|ref|YP_211696.1| Na(+)-translocating NADH-quinone reductase subunit D [Bacteroides fragilis NCTC 9343]
    MSQLFSKKNKEVFATPLGLNNPVTVQVLGICSALAVTAKLEPAIVMGLSVTVITAFSNVVISLLRKTIPNRIRIIVQLVV
    VAALVTIVSEVLKAFAYDVSVQLSVYVGLIITN
    CILMGRLEAFAMANGPWESFLDGVGNGLGYAKILIIVAFFRELLGSG
    TLLNFRIIPESFYKMGYINNGLMLMPPMALIICACIIWYQRSRCKELQEK

    >gi|60681553|ref|YP_211697.1| Na(+)-translocating NADH-quinone reductase subunit E [Bacteroides fragilis NCTC 9343]
    MEQLLSLFVRSIFVDNMIFAFFLGMCSYLAVSKNVKTAVGLGIAVTFVLVVTLPVNYLLQTKVLAANAIIEGVDLSFLSF
    ILFIAVIAGIVQLVEMVVERFSPSLYASLGIFLPLIAVN
    CAIMGASLFMQQRITMDPSNPQAITGVGSAVVYALGSGIGW
    LLAIVGLAAIREKMAYSDVPAPLKGLGITFITVGLMAMAFMCFSGLKL

    >gi|60681570|ref|YP_211714.1| putative transmembrane cation-transporting ATPase [Bacteroides fragilis NCTC 9343]
    MSNITKKAFPVLNMHCAGCANNVEKTVKKLAGVVDASVNFATNTLSVSYEADKLTPGEIRAAVLAAGYDLIVEEALKEER
    QEEAQEKHYRLLKRQVIGAWIFVVPMLLFSMVLMHVPFSNEIQLILALPVMIFFGGSFYVNAWRQARLGRSNMDTLVALS
    TSIAFLFSVFNTFFPEFWYSRGLEPHVYYEAAVVIIAFVLTGKLMEERAKGNTSTAIRKLMGLQPRVARVLREGIEEDIL
    IDQLQTGDLVVVRPGEQIPVDGRLSEGESYVDESMISGEPIPVEKKVGDRVLAGTINQKGAFVIKASGVGSETVLARIIR
    MVQEAQGSKAPVQRIVDRVTGIFVPVVLCIAVLTFVIWLLVGGTDYFSHALLSAVSVLVIACPCALGLATPTALMVGIGK
    AASNHILIKDAVALEQMRKVNVVVLDKTGTLTEGHPTVSGWLWAQVQEEHFKNVLLAAELKSEHPLAGAIVSSLQEVEKI
    VPAQLESFESITGKGIKVVYQGDTYWVGSHKLLKDFSASLSDVLAEMMVQYESDGNSIVYFGRGTEVLAVVAIADQIKPT
    SAEAVKELKRQGIDICMLTGDGQRTALAVSGKLGIDRFVADALPDDKEEFVRELQMQGKTVAMVGDGINDSQALALADVS
    IAMGKGTDIAMDVAMVTLMTSDLLLLPRAFELSKQTVKLIHQNLFWAFIYNLIGIPIAAGILFPVNGLLLNPMLASAAMA
    FSSVSVVLNSLSLARK

    >gi|60681575|ref|YP_211719.1| hypothetical protein BF2093 [Bacteroides fragilis NCTC 9343]
    MKKILFFITMMVLSIGLAQAQGKAEIKFDKTTHDFGTFSENNPVVSCTFKFTNIGDAPLVIHQAVASCGCTVPEYTQEPI
    MPGKTGTIKVTYNGTDKYPGHFKKSITLRTNAKTEMIRLFVEGDMTAKDAK

    >gi|60681716|ref|YP_211860.1| putative thioredoxin [Bacteroides fragilis NCTC 9343]
    MKVIDLTKESFVEKVAEFQEYPNKWDFKGDKPCLVDFHAPWCVYCKALSPILDQLAVEYDGKIDIYKVDVDQEPELEAAF
    AIRTIPNLLLCPMGGKPSMKLGTMNKTQLKALIEEVLL

    >gi|60681840|ref|YP_211984.1| putative thioredoxin peroxidase [Bacteroides fragilis NCTC 9343]
    MRSLIGKQAPKFDATAVINGHEIVQNFSLDQYKGKKYVVFFFYPMDFTFVCPTELHAFQEKLEEFEKRDVAVVGCSVDSE
    YSHFSWLQMPKNEGGIQGVKYPIVSDFSKSISESYGVLAGSYAPDENGNWVCEGTPVAFRGLFLIDKEGVVRHCVINDLP
    LGRNVDEVLRMVDALQHFEEYGEVCPANWSKGKDAMKATEDGVANYLSKH

    >gi|60682093|ref|YP_212237.1| electron transport complex protein RnfA [Bacteroides fragilis NCTC 9343]
    MEYILIFISAIFVNNIVLSQFLGICPFLGVSKKVDTALGMSAAVAFVLTIATIVTFLIQKFVLDAFGLQYLQTITFILVI
    AALVQMVEIILKKVSPALYQALGVFLPLITTN
    CCILGVAILVIQKDYDLLTGVVYAFSTAIGFGLALVLFAGLREQMSLV
    KIPEGMKGTPIALITAGLLAMAFMGFSGVV

    >gi|60682094|ref|YP_212238.1| electron transport complex RsxE subunit [Bacteroides fragilis NCTC 9343]
    MNNFKVLMNGIVKENPTFVLLLGMCPTLGTTSSAINGMGMGLATMFVLICSNVVISLIKNLIPDMVRIPSFIVVIASFVT
    LLQMVMQAYVPGLYATLGLFIPLIVVN
    CIVLGRAEAFAAKNNALSSMFDGIGMGLGFTIALTLLGAVREFLGTGKVFNLS
    IIPEEYGMLVFVLAPGAFIALGYLIALINSLKKAN

    >gi|60682167|ref|YP_212311.1| putative exported thioredoxin [Bacteroides fragilis NCTC 9343]
    MKKSILIPFLFMGLLAFASCKGTSENKSTTATDTVQAEKPQSGTIHLTRAEFLKKIADYENHSKEWKYLGDKPAIVDFYA
    DW
    CGPCKMVAPILEELSKEYAGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGALSKEQLKGYIDKVLLK
    Q

    >gi|60682212|ref|YP_212356.1| putative lipoprotein/thioderoxin [Bacteroides fragilis NCTC 9343]
    MKKLTYLAVAAVALGVASCNTNKPGYVITGTVEGAADGDTVFIQERVNRQFNKLDTAIIANGTFTFEGAQDSVVNRYITY
    SKDGDGVYVDFFLENGKIKVNLSKDDKSATGTPNNDAYQEIRNKINAIDQKQAAIYQAMGDSTLTDDQKMAKQKEFSELE
    EAYSQAIKEGVQKNITNPVGIMLFKQSFYENSTEDNDALLKQIPANYQNDETIVKIKDITEKQKATAAGQKFIDFEMLTP
    DGKPVKLSDYVGKGKVVLVDFWASW
    CGPCRREMPNIVEAYAKYKGKNFEIVGVSLDQDADKWKDAIKKLNITWPQMSDLK
    GWQNEGAQLYAVNSIPHTMLVDADGTILARGLHGEKLQTKLEEVLNK

    >gi|60682249|ref|YP_212393.1| putative thiol peroxidase [Bacteroides fragilis NCTC 9343]
    MATTNFKGQPVKLIGEFIQVGKVAPDFELVKSDLSSFALKDLKGKNIVLNIFPSLDTGVCATSVRKFNKMAAGMKDTVVL
    AISKDLPFAQGRFCTTEGIENVIPLSDFRFSDFDESYGVRMADGPLAGLLARAVVVIGKDGKVAYTELVPEITQEPDYEK
    ALAAVK

    >gi|60682469|ref|YP_212613.1| hypothetical protein BF2999 [Bacteroides fragilis NCTC 9343]
    MKYLYVLLAFSFLFSCKDENKKHAESVLREWMNKEIVFPNKMYFSIQGKENVDFRIKDTEYKIVAYVDSAGCTSCKLHLS
    KWKELIHYVDSTQSERVQFLFFFFPKNGRDIYHTMRMDKFTYPVCVDTLDSFNKLNHFPDDVRFQTFLLNKENKVVAVGN
    PIHNPNIRDLFLNIISGGTSLPDEKRPQTEVKIEALSMDLGMFDWKKEQKCIFTVENTGKELLVIDDVNTS
    CRCTTVEYS
    REPVQSGKTVDITVVYKAEYPEHFNKTITVYCNSPVSPLQLKIKGDAK

    >gi|60682485|ref|YP_212629.1| putative thioredoxin [Bacteroides fragilis NCTC 9343]
    MEKFEDLIQSQSPVLVDFFAEWCGPCKAMKPILEDLKQQVGEKARIVKIDVDTHEELAVKYRIQAVPTFILFKKGEAVWR
    HSGMIQASELKGVIEQYT

    >gi|60682486|ref|YP_212630.1| putative thioredoxin family protein [Bacteroides fragilis NCTC 9343]
    MFAVNDGVKADQNKKEAKSGEVIVMNKEMFINDVFDYQNSKEWKYKGDKPAIIDLYADWCGPCRMTAPIMKSLAKEYDGK
    IVIYKVNVDKEKELAALFNATSIPLFVFIPMEGEPQLFRGAADKATYKKAIDEFLLKQK

    >gi|60682503|ref|YP_212647.1| putative exported cytochrome C biogenesis-related protein [Bacteroides fragilis NCTC 9343]
    MKKLSFFLLLLLVVFTAQAQIQEPVKFKTELKTLSGAEAEIVFTGTIDAGWHVYSTDLGDGGPISATFNVEKMSGAEVVG
    KLTPRGKEVSDFDKLFEMKVRYFEKTAQFIQKIKFTGSDYSIEGYLEYGACNDENCLPPTQVPFKFSGKAAATAEVSAKE
    TPATPVKEPVATVTDSIVEPTATTVTTAIGSVDLWKPVINDLKKFGEANSQEDMSWIYIFITGFLGGLLALFTPCVWPII
    PMTVSFFLKRSKDKKKGIRDAWTYGASIVVIYVALGLAITLIFGASALNALSTNAVFNILFCLMLIVFAASFFGAFELTL
    PAKWSTAVDSKAEATSGLLSIFLMAFTLSLVSFSCTGPIIGFLLVQVSTTGSVVAPAIGMLGFAIALALPFTLFALFPSW
    LKSMPKSGGWMNVIKVTLGFLELAFALKFLSVADLAYGWRILDRETFLALWIVIFALLGFYLLGKIKFPHDDDDTKVSVS
    RFFMALVSLAFAVYMVPGLWGAPLKAVSAFAPPMKTQDFNLYTNEVHAKFDDYDLGMEYARQHNKPVMLDFTGYG
    CVNCR
    KMELAVWTDPKVSSIINNDYVLITLYVDNKTPLTEPVKIMENGTERTLRTVGDKWSYLQRVKFGANAQPFYVLIDNEGNP
    LNKSYAYDEDISKYINFLQTGLENYRKEK

    >gi|60682526|ref|YP_212670.1| putative thiol:disulfide oxidoreductase [Bacteroides fragilis NCTC 9343]
    MKHILFTLALASIAGIANAQHNGHSYTVEGLINDSTLNGQTLYISRYDDGMKVDSTQVTNGQFKFTGKADIPCFCRIDAG
    REYANFILEGGNIQVNVLTHNDPKGTPMNEEYTHISDKTSELVTELRKRHAAIEQQTEDKSEQLRLKKEYADTYWHPTYT
    RLYKDMFMKNPDNALGEFAIRELAMCALPEEMDTIFAASGPWLKSLSVYHRIEKQFQGMKATAVGQKFTDFSGKTIDGAA
    SSLSDFVGKGQYTLVDFWASW
    CGPCRSESPHIAELYNTYKDKGLTVLGVAVWDKPENTKKAIKELNIDWPQIIDTGMTPM
    DLYGVKGIPFILLFGPDGTIIARDLRGEGMKNKVAEVLNNK

    >gi|60682528|ref|YP_212672.1| hypothetical protein BF3059 [Bacteroides fragilis NCTC 9343]
    MNTIFKTTGLCVFLFACTPWAAAQNSSIDYPSYQKRNTDALEISRIVRNDTATILYMDAYSRPNYWIRLASELSLHGVQS
    GKKYPVIRSQGFELDKQVYMPASGNVTFTLQFAPIDPQDRTIDFVESNNEEDFRIEGICLDASVPKKKVHCHLAGKMANR
    PQTSRLILIESNKNTRGTPWISIPVRNGVFEYDFYTDHEKAYELICWDDLLNGCWYPVTFFAENGTVSFTISAIDARPPY
    RIETLNSLTTALRLFEAEGKDKFSFDELNARRDTLEKYGRFESEAMQALWKKFDQVKDNPEERNKLFRERDRLEESGEAF
    TKEAKALIKEREQLFRKKVIWETEQASQHPSLVGLFILKMKVENARKDEDVTPYLEAFQKVYASRYPEHPYTREMQMFID
    NNQPKTGNRFIDFSAPDLNGNMVQLSEQIRGKVALIDLWASW
    CGPCRTTSKQLIPIYEKYKDRGFTVIGVAREQNSDIRM
    REAIRKDGYPWLNLIELNDVQQIWSKYRIPNAAGGTFLVNAQGIILAVNPTAEEVERILQKEL

    >gi|60682610|ref|YP_212754.1| hypothetical protein BF3141 [Bacteroides fragilis NCTC 9343]
    MHAQHFVIEGKTNGYVPDGSILYLGRWNGMGAMIYFTSDMIRNGTFRLEGKREKTPDIIYLYGTEKAIGTLNLRLWVGDD
    TIRVSANSEVPETWIVENNMPQQAEEDFYRQLKGKDNIIKTSRMNSRQLWDRSLTPDSVRILTNQIIQNDLPGQIRILSH
    LHKQPKLTDTGLVYFFLSSGYAHWMTNPKHLCMGREIYGQLTGKQKQTYYGKFAKSYFYPDKTPEKGDYYIDANLFDLKG
    DSCKLTDYLNKGKYILLDFWDLY
    CAPCKKSVPGLKELFSSCADKLTIISINVGSRESQVKGSSDFLWENLSDGQGLTGIA
    SRYGIKSIPCFILIAPNGRIEKYWKGYAMHHSGMEKEIMEIILPNPSPTEASK

    >gi|60682642|ref|YP_212786.1| DNA methyltransferase protein [Bacteroides fragilis NCTC 9343]
    MKDYKENKSNLSETFCNEVYSVVREIPAGSVTTYGDIAALLGMPQYSRMVGRALRQVPAGLNLPCHRVVNAIGRLVPGWD
    EQRRLLDAEGVSFRKNGCVDLRLHRWRDDSVLAD

    >gi|60682680|ref|YP_212824.1| hypothetical protein BF3211 [Bacteroides fragilis NCTC 9343]
    MKSKLLFLLLLLGSSYITAQTVIENPPFETRQGSIHTISKIELSPTETRLTIRTVFRPQWWTSLDSLTYIYAPESKKQLY
    PLRIEGRKFGEQVTTPASGIIEDDCVITYPPLPEGTTRIDWMDDNLNSETNTYGILLVKPQETKEQASLRKIHGNWQQAD
    AQNGWDIGIYDSLAIMDNRFWKYDLCRKQGKKFKLNLKDETGEQCLLEITQEKDGNLCIGKNGGKANKYIRAGRPQRNYA
    ATTAATAPQTAFFRKDTVHIRGFLDGYSPKLGFTTVLIYTDNHITNEGTPAVVTIHPDGRFESDFVVNYPGVHHLSMGNN
    WMTFYIRPGETLMLYINWEDHLDYLRQRRLKPMLTETLYMGPSSSINQELMPCEPLFSKDYHIIQNACKTLTPSEFKTQQ
    EPMYKLWMHRVDSLEQSKTLQPEAMQMLKNDVMINYGAWLLEFILMRDMDARKDTTNTILKIKETPDYYDFLKAMPLNDV
    RSIGCNNFSTFINRIEFMNPFLPASWQIKNGTDDRMEKYAESWRKKKEILQDTTGMPFPVVGELILTRSYPFLAKTLENE
    KKAFALLDTLKGYLHDPFLVAEAERMYRQVYPVQGNKPQELPAGKGTDIIRKLTAPYLGKFVIIDFWATS
    CGPCRASIEQ
    HADLRKDYRNSPDIKFIFVTSNQDSPEKAYENYVEKHLKEETIFRLPQSDYNYLRELFHFNGIPRYVLLDRDGKLLDENF
    PMYNIELFLKESKIRKE

    >gi|60682802|ref|YP_212946.1| hypothetical protein BF3335 [Bacteroides fragilis NCTC 9343]
    MKSILLSVISFLLVMNVCGKNDVDMRTYLKKVLGNLGKIESASYHEQSQSWQPGDTVAITNFHRFIKEYTNPSDSTIGAS
    YVCLDAKDTTRFEFGYDGNVRMISYHEHKGIMIDDFTTRSLPFRLVAPPFFCYTRNIIGYALSTGDSITTEWKDLGEAYY
    FKLVIHEDRQVEFFGKAYYIPKPPFDLGDPTSIYELWISKADGLPYKMRREMSHQISATTCSDVVLNQLSIAGLNLYDYV
    PQDYEIRKYGEQKKVTQPAATDLIGQKAPDWMLKDMYEKPVALSEFKSKVLLVNLTGIG
    CGACHASIPFLNGLKGKFNAG
    EFEVVSIETWGREPHSLRTYADKNQINYSFLCGDEGIVKSYRTYGAAPLFFILDQDRVIRKVIRGYRMGRTDEEITDAIK
    ALL

    >gi|60682841|ref|YP_212985.1| bifunctional methionine sulfoxide reductase A/B protein [Bacteroides fragilis NCTC 9343]
    MKKKFTIFVVLLAGIIYTGHAQGVQWIYQQKQEKKNMKNLSEIYFAGGCFWGTDHFLKQIRGVKSTQVGYANGNIANPTY
    QQVCTGKTNFAETVKVEYNPQEVPLKLLIDLFFKTIDPTSLNRQGNDKGSQYRTGIYYTDKVDLPTIRTAIDELAKEYSK
    PIVIEVKPLSNFYKAEEYHQDYLDKNPGGYCHINPALFELAKKANAQAEQPQTNYKKPDDATLRSKLTPEQYAVTQKNAT
    EPAFHNEYWDEKRDGIYVDITTGEPLFISTDKFDSGCGWPSFTKPIEKEVIKEKMDTSHGMIRTEVRSKTGDAHLGHVFT
    DGPKEKGGLRY
    CINSASLRFIPKEKMKEEGYGEYLKLLPQK

    >gi|60682849|ref|YP_212993.1| ArsC family protein [Bacteroides fragilis NCTC 9343]
    MKTLFLQYPACSTCQKAKKWLIENNIEYTNRLIVDDNPTVEELKAWIPLSGLPVKKFFNTSGVVYKELKLSSKLPTMTEE
    EQIALLATNGKLVKRPLVVTERFVLVGFKPEEWEKLK

    >gi|60683073|ref|YP_213217.1| hypothetical protein BF3623 [Bacteroides fragilis NCTC 9343]
    MKKLLLILLLVLAGEISAQQAATIVVKTTPDNEIAYWPTGKEHLFCIALGTKAQAGPLGEFVHQFRTDRPGMVQVWTQGS
    DSFTLYLTPGSKDTITVTKDTLIISGTNSAYNRCLKTVNDYQKYSDKLVYMQPHELRGITSLEQYHRLADARMRQALDAV
    NASGLNEEFLAEQRAHIDYIRRSIFIHIARQLSRKEKLPEDWQRELTEVINSSVNGDYLRSYRGIGFFVNDLVMMQFTNL
    ENGDLKEIKEYASFLFDRYRKFFTGDNLQYMQAQLIYEDEFQGSKTPSIPQLYETYRAEFPNSPFLNVLEPGVKENLRFQ
    NSRITDKDYHILTCDSTITSLEDAVKPFKGKVVYIDVWATW
    CGPCLKEFQYLPTLKEKAHNMDVVYLYISIDRPEERKKW
    EKTIAYHQLKGYHLLVNEKLGKSLYTELGNERQILSIPCFVIIDKTGKIVIRHAAAPSEPEKVIEQLSTYYNK

    >gi|60683105|ref|YP_213249.1| putative glutathione peroxidase [Bacteroides fragilis NCTC 9343]
    MAAQNKSFYDFTVKTIDGKEYPLSGLKGKKVLVVNVASKCGLTPQYAELQELYDQYKDQNFVIIGFPANNFMGQEPGTNE
    EIAKFCSVNYDVTFPIMAKISVKGKDMAPLYHWLTEKKLNGKQDAPVQWNFQKFMIDENGNWVGFVAPKESPFSETIISW
    IEKK

    >gi|60683213|ref|YP_213357.1| putative exported thioredoxin [Bacteroides fragilis NCTC 9343]
    MKKITFIAILLLCICSLTKAKEKVIEQPPFIAWTSTSIQVDKVVLSDTATVLYIKAFYHPKQWIRISGQSFLKDNNGETY
    TLRSGIGIKPDTEFWMPESGEGEFRLVFPPIPVSATSIDFSEGDNVQGAFKIWGIQLKGKALPELLLPQEAIVHKIDIND
    ELPEPKIEYKDATIKGRILDYRPGLVSKIVPIIFDPVKGAYESEEVKINNDGTFVTRVKVPTTTSAAIRLFGKMITFYAV
    PGEESSVIINTRELCRQQSKFHKDDKPYGEAVYFGGTLAGLSQEYSNCTLKTSILNDYRQLFKDVAGMDAGAYKDFIYGK
    RANLLASIEKAPISKALKAVLGNQVDAEAAQAISLTEMVIKQAYTMEHKMSKEEAREYFNTAQIELPENYYANAFRPLAS
    INTMAALYNSKLSELIPYYLRRRTDELTKAWGTDKGIYFDINKAGELYSSIKEFTPLTAEQEVILATLPPACQNEVRDAN
    NQLLKTLEANKKKTGFTINEVGDVSNEELFSSIISKYRGKVILVDFWATW
    CGPCRMANKAMLPLKEELKGKDIVYLYITG
    ETSPLKTWENMIPDIHGEHFRLTDAQWSFLGDKFDIRGVPTYLIIDREGNVKHQKTGFPGVAQIKEELMKVYD

    >gi|60683305|ref|YP_213449.1| putative copper transport-related membrane protein [Bacteroides fragilis NCTC 9343]
    MENQNLTQENFPIIGMSCASCAARIDKVLNRQPGVSKAIVNYAAGTATVVYTPSVCTPNALQQAVQAAGYDLLIQQTPNM
    LEEVEVVHDQKYHALKLRTIWAIILSIPIVIIGMFFMDMPYANLIMWILSTPVVFWLGRGFFTNAWKQLKHGSANMDTLV
    ANSTGIAYLFSLFNLFFPEFWVSRGVHPHVYFEAASTIIAFILLGRLLEEKAKGNTSSAIKKLMGLQPKNVTIITSTGEQ
    KEIPIEQIRPGNILLVKPGERIAVDGVVTEGASYVDESMLNGEPIAISKDKDSKVFAGTINQKGSFRFRAEKVGTDTLLA
    KIIHMVQDAQGSKAPVQQIVDKIAGIFVPTIISIAVLSFVVWVMLGGTNGFTHGLLALVTVLIIACPCALGLATPTAIMV
    GIGKGAERGILIKDAESLETAKKIDTIVLDKTGTVTEGKPKVSTVVWNNLSENAESIFYSLEKLSEHPLAEAVTSYFKDT
    RQIEIKHFESITGKGVKGESEGKTYYAGNRQLLEEHKIAISSVLFNNFTHLTAEAQTVIWFADDTNALAIVAITDQIKKT
    SIQAVTELKAANIEVHLLTGDNETTAREIARKAGIQHYKAGVLPQDKAAFVRQLQKKGKKVAMVGDGINDSAALAQADLG
    IAMGSGSDIAIDVAQMTVISSDLTKIPEALELSRQTVRTIRQNLFWAFIYNLLGVPVAAGILYPINGFLLNPMIAGAAMA
    FSSVSVVSNSLRLRKKKIQNADVSVNLSVTEQDRELEEKVETLSEKFMKKEFKVEGMS
    CNHCRMRVEKALNKMEGIRATV
    TLNPSVAIVEFTNGEKTLEELQNMVTQEAGDYVLRE

    >gi|60683535|ref|YP_213679.1| putative methylated-DNA--protein-cysteine methyltransferase [Bacteroides fragilis NCTC 9343]
    MENVIQIQYYQSPCGELILGAYREKLCLCDWKIEERRIIIDRRIQKELQASYKEGISEVIARTIGQLDEYFAGRRTTFDI
    PLLLVGTDFQKTVWNELLNIPYGKTISYAGLSQKLGNPKAIRAIASANGANPISILVP
    CHRVIGSDRKLVGYGGGLPAKK
    ILLDLESSDRLF

    >gi|60683696|ref|YP_213840.1| thiol-disulfide oxidoreductase [Bacteroides fragilis NCTC 9343]
    MRKIGLLFITIFCLLACKNNSSRISLEGEIKGLTNDTLYLYGTDALYDRIDTIYAEKGKFSYNLNIDSTVIDTLTTAVLL
    INGHVEYPVFLDKGNQITIKGNIDDLSYLDINGNEPNTSLSLFMKEQRGLGSASDKMMQEKAETFIRQHNSSLASVYLLD
    KYFVQTPQPDYIKIKEITEAMTGALLDRPYIENISDYIDQLEKVTVGKSAPYFSLPNEKGEKLSRSAERFRNRYLLLNFW
    ASW
    CDPQPEANAELKRLNKEYKKNKNFAMLGISLDIDREAWETAIKKDTLSWDQVCDFTGLSSETAKQYAILTLPTNILL
    SPTGKILARDIQGEALTGKLKELLKTEEKKTGKSIR

    >gi|60683706|ref|YP_213850.1| hypothetical protein BF4294 [Bacteroides fragilis NCTC 9343]
    MGLCGYFFVYLASGFVVCVKCLLLMRAIFIFVCILLFVSCQNSDKSRIAHMIDEWDGKEIIYPDDLVFTTMGEDTVKWFL
    KDSRYTIVTYADSIGCMGCKLKLPVWKDFISYLDSVSDHTVKVIFILHPRDKKEMVHLLEYNDFSYPVCLDIKGSFDKIN
    KIPSNLAFQTFLLDNRNKVIAIGNPIHNPNVRTLYLNLILSDSICKSRDLIQTKISLPETIDMGVFDWSEEKEAMLIIKN
    LGVVSLTVENIVTS
    CGCTSVEYSRRPVSLKDSLVIKIKYKAESPGYFNKDIAIYCNVPSSPVYVKLSGKAQ