Xenorhabdus bovienii SS 2004 uid46345

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|290473228|ref|YP_003466093.1| thiosulfate:cyanide sulfurtransferase (rhodanese) [Xenorhabdus bovienii SS-2004]
    MDRFQTINPEQAYQHWLNKTAVMVDIRDPQSFRAGHTTGAFHLTNETLNNLLQETDFDQPVMVMCYHGHSSQGAAQYLVN
    MGFETVYSVNGGFDVWQRSYPEAVNTL

    >gi|290473232|ref|YP_003466097.1| hypothetical protein XBJ1_0146 [Xenorhabdus bovienii SS-2004]
    MPKELFTAEIESSGHLKMQCSTRGFSFHVDEPKNLGGTDEAMNPVEALLSAFGACQCIVAKSFARKHKINLIDIQVKMEG
    ELDTDGFTGRNKNTKMGFSKITSKFYIKADNTEQEIRDFIDFVESNCPVLDTILNAPEIVTEVYPSR

    >gi|290473420|ref|YP_003466286.1| peptide methionine sulfoxide reductase [Xenorhabdus bovienii SS-2004]
    MPNSANESQHVSTQDALLGRAIPLTVSPYHVITQHSINDIPENMEIAYIGMGCFWGVERLFWQQEGIYTTSVGYSGGTTP
    NPTYEEVCTGLTGHAEVVRIVFDPTKITYGQLLTLFWENHDPAQGMRQHGDIGTQYRSAIYTISSQQYEQALATREQFQQ
    AMNENGDQRTITTEIHAAKPFYFAEDYHQQYLFKNPEGYCGLGGIGVCLLPTHKN

    >gi|290473617|ref|YP_003466489.1| Pb/Cd/Zn/Hg transporting ATPase (P-type ATPase family) [Xenorhabdus bovienii SS-2004]
    MFSIFKKHKQSQHGSLSHKNKDHKHSHGVHGKEDKSSHNAHEHDRGHCSHDHAPTIQDTTPLELTANQRFNWIIHGMDCP
    SCAGKIENAVKKLPEAKQVRVLFTTEKLVVDADSDIRAAVEQAVKQAGFEIKQTDSTIRLPPAANHWKTFSPILILIALM
    VISWGITKINPPAGQIAFIVTTLIGLYPVATKAIKLIRSGTPFAIETLMSVAAIGALFIDATAEAAMVILLFKVGEVLES
    YAAGRARRGVSALMALVPEQALRVTGGEKKTVPAADLRPGDIIEIAPGARLPTDAELLSPFASFDESALTGESIPVERQQ
    GEKVAAGCLSVDSAVQMRVFSEPGHNAIDRILQLIEEAEERRAPIERFIDRFSRIYTPLIILFSVLVVVIPPLLLAEPWE
    TWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKGGAALEQLGSVTTIALDKTGTLTEGKPRVTEIEPVENIS
    VETLLALAGAVESGSHHPLAKAILNAAENKGVTVVEAEHRKALAGIGVEGRLSGQKILVAAPGRLPENTLSTAWKQRVTE
    LESNGKTAVAVVQGEQFVGLIAMQDTLRQDAIDAIRALKKQGVNAVMLTGDNPRAAAAIAAQLGIDYRAGLLPEDKVKAV
    TELNEKHHTMMVGDGINDAPAMKAASIGVAMGSGTDVALETADAALTHNRLTGLPEMIALSRTTHYNIRQNITIALGLKA
    IFLITSLLGITGLWMAVLADSGATALVTANAIRLLRVKSQKR

    >gi|290473951|ref|YP_003466825.1| thioredoxin reductase, FAD/NAD(P)-binding [Xenorhabdus bovienii SS-2004]
    MSTAKHSKLIILGSGPAGYTAAVYAARANLNPVLITGVEKGGQLTTTTEVENWPGDPEGLTGPDLMERMFQHAEKFQTEI
    ISDHIQKVDFEKKPFRLYGDDQEYTCDALIIATGASARYLGLPSEDAFKGRGVSA
    CATCDGFFYRKQKVAVVGGGNTAVE
    EALYLANIAAEVHLIHRRDTFRSEKILIDRLMEKVKNGNIILHTDRTLDEVLGDDMGVTGIRIHDTKSDNAEELDVTGVF
    IAIGHSPNTGIFEGQLDLQNGYIKVQSGLHGNATQTSIPGVFAAGDVMDHVYRQAITSAGTGCMAALDAERFLDGLATK

    >gi|290473968|ref|YP_003466842.1| glutaredoxin 1 redox coenzyme for glutathione-dependent ribonucleotide reductase [Xenorhabdus bovienii SS-2004]
    MYTVIFGRPSCPYCVRAKELAEKLKAERDDFDYRYIDIWAEGITKDDLSKTVGKPVETVPQIFLDEKHIGGFTDFEAYAK
    EHLNLYK

    >gi|290474007|ref|YP_003466881.1| ATP-dependent adenylate transferase, modifies MoaD [Xenorhabdus bovienii SS-2004]
    MVIELTDEEILRYNRQIVLRDFDFDGQEKLKSSNVLIVGIGGLGCAASQYLTSAGVGTITLLDFDAVSLSNLQRQILHRD
    ERIGIPKVHSAAQTLREINPHVTLHPIEGLLDDPSLNELIGRHDLILDCTDNVAIREQLNRLCYERKVPLVSGAAIRMEG
    QLAVFTYQPDEPCYRCLSRLFGENSLT
    CVEAGVMAPLVGIIGSLQAMEAIKLLTQYGKVSRGKVLLFDAMTLQFREIRLP
    KDPQCEVC

    >gi|290474023|ref|YP_003466897.1| 3-mercaptopyruvate sulfurtransferase [Xenorhabdus bovienii SS-2004]
    MKNEYFVSPQWLNDHLHDENVVIVDASAPMPTQTIDYHQLWLDNHIPGAQFFNLDKIANLQTNLPHMLPEPEVFRQAVSA
    MGISENHLVIIYDQGNMFSAPRAWWTFKIFGTRNIRILEGGLQGWQQMGYPTESGEVTRQPQIFNSQFTPEKVCSQEQIL
    DALHHKAPIQFIDARAEDRFQAKVPEPRPGLRMGHIPGSKNVPWTTLIDNGSYKSPDEIAAIFKKQGVDLKQPIMTS
    CGS
    GMTAAVLVLGLDMIGHKEVGLYDGSWAEWGADDSLPLEK

    >gi|290474494|ref|YP_003467374.1| thiol:disulfide interchange protein, cytochrome c-type biogenesis, electron carrier, N-terminal interacts with and activates DsbC [Xenorhabdus bovienii SS-2004]
    MMKRILILFLLLGGIAISPVKANALFEQPGQNRYLPVAQAFVFDFQQKGNELTLNWDIKPGYYLYQKQFIITPIKATLGH
    LNFSESVDHEDEFFGKTKVHFGSAQINAPILSASNDSNLQVTYQGCAEAGFCYAPETITVPLSAIIASAPSANEAAKQPD
    ITTSQKASLPQEESPPNVPDVPFSPLWALLIGIGIAFTPCVLPMYPLISGIILGQRRPDSLKRIFWLAMSYVQGMALTYT
    VLGLIVAAAGLQFQAALQNPYILVGLSILFILLALSMFGMYSLQLPSSVQTRLVDWSNQQKSGSYIGVFVMGILAGLIAS
    PCTTAPLSAILLYIAQSGNTLLGGLTLYLYALGMGLPLIAVTLFGHKLLPRRGPWMQYVKEAFGFIILALPVFLLERVLG
    DTWGIRLWSLLAIAFLGWAFALTLNSKKGWLRTLQLILLVLTLIASRPIQDWVWGNSATTQQQPSLKFQQVSNWQELSQI
    LAKNRHQLIMLDLYADW
    CVACKEFEKYTFPDPQVQAQLSQFLVLQANVTENGSKQKELLDKLKVLGLPTILFFDAHGKEL
    PDSRVSGFMDAGRFSRHLQHLQK

    >gi|290474617|ref|YP_003467497.1| putative thioredoxin protein with protein prenylyltransferase [Xenorhabdus bovienii SS-2004]
    MESITNTNSHTAHIIHINESNIASMIQHSLTQLVVFYFWSPQNLHCHELEETLDKLAHEYAGQFALAKVDCDQLPNVAAQ
    FGIRTAPTVIFVQEARPVHGFEGIQTDETIREMFSQFLTQQKKSLLEQANERLAEGKNQEALPLLKEAHQAEPKETEITL
    LLAQVYISLNHLEDAQNILDTLPLEEQDQRYNDLLAILESQKQAANSPEIQQLQQALEIQPENAELAVQLAAKLHNVGRN
    EEALELLFSFLKKDLSAADGAVKKTLMDIISALETGDTLASQYRRHVYSLLY

    >gi|290474621|ref|YP_003467501.1| P-type ATPase, copper transporting, phophatase-like domain [Xenorhabdus bovienii SS-2004]
    MSTTTILTLQGLTCMHCVGSVKKALENVSGVEQTDVTLDYAKVIGNVSSTVLITAITDAGYEAVVATQPDIELQLSGLSC
    MKCAGKTQKALESVEGVIAAKVDTQTAKIYGKVESNALIKAVEQAGYHAELAAGTRFPKTEPLTISAPQTPEFLAAAENA
    TPVRNPENTVSHDTPDNDNDSIQLLLDGMT
    CASCVSKVQKALQSVDGVENARVNLAERSALVTGAVSPNALVDAVIKAGY
    GAEVIQDETERRERQQQVAQANMRRFRWQSAFALAVGVPVMVWGMLGDNMVLTPSNHAIWLTIGLVTLAVMVFAGGHFYR
    NAWQSLKNGSATMDTLVALGTGVAWLYSISVNLWPEIFPSQARHLYYEASAMIIGLINLGHALEQRARQRSSKALERLLD
    LTPPTARVITEKGEKTLPLADVKPNMILRLTTGDRVPVDGEIIQGTVWLDEAMLTGEPIPQQKSTGDGIHAGTVVQDGTV
    LFRAAAVGSQTTLARIIKLVRQAQSSKPEIGQLADKISSIFVPVVIAIALVAGAIWYFIGPAPQLMYSLVIITTVLIIAC
    PCALGLATPMSIISGVGRAAELGVLVRDADALQQASQLDTLVFDKTGTLTEGMPQVTEISTFNGFTEEQVLLWAGALESG
    SNHPLAKAIALKVAGQKLPEVQQFRTLAGLGIRGVVGDTTLLLGNQSLLEQNQIETAELKTLMATQAEKGITPVILAADG
    KIAALFSIRDPLRQDTLSALQRLHHQGYRLVMLTGDNPVTANAIAKEAGIDQVIAGVLPDGKAAAIQTLQSEGRKVAMIG
    DGINDAPALAQADVSIAMGGGSDIAIETAAITLMRHSLNGVADAVALSRGTLRNMKQNLFGAFVYNTLGIPIAAGVLYPF
    TGTLLNPVVAGAAMALSSITVVSNANRLLRFKPKH

    >gi|290474709|ref|YP_003467589.1| putative peroxiredoxin (Thioredoxin reductase) [Xenorhabdus bovienii SS-2004]
    MVLVTRQAPDFTAAAVLGNGEIVDNFNLKNHLNGRPAIIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVIGISFDSEF
    VHNAWRKTPISEGGIGEVKYPMVADIKRDIMKSYGIEHPEAGVALRGSFLIDKNGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWAKGQEGMGASPEGVAKYLTKNADKL

    >gi|290474793|ref|YP_003467673.1| Transcriptional regulator, ArsR family/rhodanese-like domain protein [Xenorhabdus bovienii SS-2004]
    MFDKQTLVEIAEIAKVLGNTHRLTLLECLADTEQSVERLSDLSGLSVANTSQHLQHLKRVGLLQSRKEGKHVLYRQGEGP
    LADILSALLQYAEFNRTEMRRLIDDTNNQESISWEELLDRIKEKSMTLLDVRPKEEFEQGHLPNAINIPVDELGSRLDEL
    ATGQELIAY
    CRGPYCVLSANALELLRAKGVRARRFKKGFSGWKDAGMHTEV

    >gi|290474874|ref|YP_003467754.1| hypothetical protein XBJ1_1850 [Xenorhabdus bovienii SS-2004]
    MAAGFYIKLESYPDIKFPTPKGLIAWLLPHISEGDAQKLSDWFEKSSSMVARWIILELPGNNGSPVYTLNLYARRHNTDR
    GPKLGLRASRRKPVRASGELPECIRSSGLNVIDRADIHSRDLSNEIKGLETAHVVFVGVGSLGGAVASQLVRAGLKQLTL
    IDPDNLESANLGRHILGADDLGKPKAQALQYRLTRDLPTIDVAAFNTYAQFIMELKPEIFEKADLIIVTTADWESEVALW
    TKKAEGATWGLLQGWSEPHTLVGHALIAPQGAHDGRYLFSDNGDFIHRYTNWPEGGVIPLPA
    CGESFIPGGSAGMTNIAA
    MVAQAAIRFLNTHQHGPAWVTSLYRPQDAVLSGGKYLGPELPEGTILSVLERGWPESEKNNI

    >gi|290474919|ref|YP_003467801.1| hypothetical protein XBJ1_1897 [Xenorhabdus bovienii SS-2004]
    MPVLHNRISNKELKERMLAEIEPRTTISFYKYFTISELQAFRDSLYQKFTELSVFGRVYIAKEGINAQISVPSKNVDALK
    ALLDATDPALCHLRLNIALEDDGKSFWVLRMKLRERIVADGIEDETFNPSNTGEYLKAEQVNQMLDDPDTLFVDMRNHYE
    YEVGHFENAIEIPSDTFREQLPMAVEMLKDNKDKNIVMY
    CTGGIRCEKASAYMLHNGFDKVYHVEGGVIEYARKAKEQGL
    PVRFMGKNFVFDERMGERISEDIIAHCHQCGTACDSHINCKNDGCHLLFIQCLSCAEQFEGCCSDICREEMKLPEEEQRF
    RRAGRENGTKIFNKSRYRLNDGLNITSLQSIK

    >gi|290475315|ref|YP_003468203.1| putative NADH-quinone reductase, membrane protein [Xenorhabdus bovienii SS-2004]
    MSETKKLLSQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLLSTNVAVSALRHWVPHEIRIPIYVMIIASVV
    SAVQMLINAFAFGLYESLGIFIPLIVTN
    CIVIGRAEAYASKNSIYNSTIDGLAMGLGATFSLFVLGAIREILGNGTIFDG
    ADLLLGSWAKSLRLEIMHMDSPFLLAILPPGAFIGLGLMLAGKYIIDKRIKNRADNQARRYDNVEKGCGSHITKS

    >gi|290475320|ref|YP_003468208.1| putative oxidoreductase, inner membrane protein [Xenorhabdus bovienii SS-2004]
    MTEYLLLFIGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVLTLASISSWLINTFILVPLDLVYLRTLSFILV
    IAVVVQFTELVVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLNVNQSHNFLQSAIYGFSAAVGFSLVMVLFAAIRERLAV
    ANIPAPFRGSSIGLITAGLMSLAFMGFSGLVKF

    >gi|290475447|ref|YP_003468335.1| hypothetical protein XBJ1_2445 [Xenorhabdus bovienii SS-2004]
    MPTEIRLTQYSHGAGCGCKISPKVLETILRSEWPKFFDPNLLVGNETRDDAAVYDIGNGTGIISTTDFFMPIVDDPFDFG
    RIAGTNAISDIYAMGGKPVRRLRFWAGQLLNYSQKSRKKLLKEIGPYVN

    >gi|290475453|ref|YP_003468341.1| methionine sulfoxide reductase [Xenorhabdus bovienii SS-2004]
    MAKTKNTSLFIEQLSEIQRYVTQKAGTEPPFSGKLLHNKKSGIYHCLCCRQPLFISDTKFDSGCGWPSFYQPFNDKSINC
    IDDYSHNMHRIEVRCSHCQAHLGHVFPDGPKPTGERF
    CINSAALRFIDEETGDETEG

    >gi|290475462|ref|YP_003468350.1| disulfide bond formation proteins (oxidoreductase) with quinone as electron acceptor, reoxidizes DsbA [Xenorhabdus bovienii SS-2004]
    MFRFLKQSSQGRSAWLLMALTALILELTALYFQHVMKLQPCVMCIYERIALFGILGAALLGAITPKTPLRWLAILLWLYS
    GWQGLQLAWDHTMMQLHPTPFNT
    CEFFVRFPSWLPLNEWLPSVFQATGDCSVKQWSFLTLDMPQWLIGIFAAYLVVGVLV
    LISQFFIIRGKN

    >gi|290475469|ref|YP_003468357.1| thiol peroxidase [Xenorhabdus bovienii SS-2004]
    MTQTVKFQGSDITINGDFPQVGQTTKEFSLVAKDLADVTLSQYAGKRKVLNIFPSIDTGVCATSVRKFNQVASELNNTVV
    LCISADLPFAQSRFCGAEGLSNVVMLSTLRGGKFHEDYGVAISQGPLVGLTARAVVVLDENNQVIYSQLVDEITNEPDYD
    SALSILK

    >gi|290475495|ref|YP_003468383.1| putative monothiol glutaredoxin ydhD [Xenorhabdus bovienii SS-2004]
    MSIEKNERPVEETTTIGKIERQIKENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWP
    TFPQLWVDGELVGGCDILIEMYQSGELQALIKDTADKYREQAGCDSE

    >gi|290475596|ref|YP_003468484.1| Protein yffB [Xenorhabdus bovienii SS-2004]
    MSDTTYHTAFTLYGIKNCDTMKKARRWLEDQEIPYQFHDYRVDGLSSELLQLFIEQVGWEPLLNTRGTTWRKLSDDQKSA
    INSTDAAKKLMLEQPAIIKRPLLVSETGNYLLGFKAEQYQQFFFHD

    >gi|290475626|ref|YP_003468515.1| putative arsenate reductase with thioredoxin-like domain [Xenorhabdus bovienii SS-2004]
    MPQVIFYHNPRCSKSRETLKLVEDLGIAPEIIHYLDTPPTVEQLTVLLKQLGFKDARQLMRTKEELYKDLNLGDDTLSQA
    ALLQAMEKYPILIERPIVVVGDKARLGRPPEQVKEILG

    >gi|290475629|ref|YP_003468518.1| thiol peroxidase, thioredoxin-dependent [Xenorhabdus bovienii SS-2004]
    MSRLKAGDKAPKFSLPDQDGKTVGVSDFKGQRVLVYFYPKAMTPGCTVQACGLRDKMNELKEIGVEVLGISTDTPEKLSR
    FVKKEMLNFTLLADIDHQVAEQFGVWGVKQFMGKTYEGIHRISFLVDPKGDIEHVFDKFKTSNHHQIVLDYLKQHSS

    >gi|290475841|ref|YP_003468733.1| respiratory NADH dehydrogenase 2; cupric reductase [Xenorhabdus bovienii SS-2004]
    MTTPKTRIVIIGGGAGGLELATRLGHKLGRKQKAEITLVDRNNSHLWKPLLHEVATGSLDDGVDALSYLAHASNHHFHFQ
    LGTLTNIDRDGKKITLAEIRDESNDLLVAERELTYDILVMALGSQSNDFGTAGVREN
    CIFLDNPQQAHRFHNEMLNLFLK
    YSANQCTEEKVNIAIVGGGATGVELSAELYNAVKQFNSYGFESLNSDALNVTLVEAGERILPALPPRISSAAHQELTKLG
    VKVLTKTMVTSADEHGLNTKDGELIKASLMVWAAGIKAPDFMKDIGGLETNRINQLVVKPTLQTTLDAYVFAIGDCASCP
    KKEGGFVPPRAQSAHQMASRCYDNILALLNEKPLKEYVYKDHGSLVSLSKFSTVGSLMGNLMRGSMMVEGRIARVVYISL
    YRMHQVALHGYIKTGLMMLVGGINRVIRPRLKLH

    >gi|290476017|ref|YP_003468914.1| putative regulator believed to be involved in Fe-S cluster assembly and activation [Xenorhabdus bovienii SS-2004]
    MSISLTESAAQRILAFLDNRGKGVGLRLGVRTSGCSGMAYILEFADTVNEEDQVFEDKGVKVIVDGKSIVYLDGTELDFA
    KEGLNEGFKFNNPNVSSECGCGESFHV

    >gi|290476207|ref|YP_003469107.1| methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) (O-6-methylguanine-DNA-
    MYHHYLNTPEGFPKPYVHITADDEGVTSIYFVNEKKELESKNTITKQCVKELQEYFKGKRHTFTVPLSMKGTEFQKRVWQ
    QLCNIPFGDMWSYKQLALTLGSVNYCRAVGMANSRNPISLIVP
    CHRVIGHDGKLVGYTGGLDIKGWLLEHEKNKKIKAKQ
    S

    >gi|290476298|ref|YP_003469202.1| putative oxidoreductase, inner membrane protein [Xenorhabdus bovienii SS-2004]
    MEHYISLFVRAVFIENMALAFFLGMCTFLAVSKNVKTAFGLGVAVTVVLGISVPANNLVYNLVLRDGALMDGVDLSFLNF
    ITFIGVIAALVQILEMILDRYVPALYNALGIFLPLITVN
    CAIFGGVSFMAQRDYNFSESVVYGFGSGMGWMLAIVLMAAI
    REKMKYADVPAGLKGLGITFVTTGLMALGFMSFSGVQL

    >gi|290476299|ref|YP_003469203.1| putative NADH-quinone reductase, membrane protein [Xenorhabdus bovienii SS-2004]
    MADSKEVKRVLLGPLFDNNPIALQVLGVCSALAVTTKLETALVMTIAVTLVTAFSSFFISLIRNYIPGSVRIIVQMAIIA
    SLVIVVDQILQAYAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKSPPVESFMDGIGNGLGYGVILLLVGFLRELFGSGKL
    LGMTVLESVKNDGWYQPNGLFLLAPSAFFIIGMLIWGLRTLKPAQVEKE

    >gi|290476401|ref|YP_003469306.1| protein disulfide isomerase II, activated by N-terminal of DsbD [Xenorhabdus bovienii SS-2004]
    MKKLAFCFSLLLTAFAGNVFANDSAVNNSLVKMGLKAESIKPSQLAGVSTVLTDQGIIHISNDGKYLFKGQVYDISGKIP
    KNVTNQVLVKKLDALKNQMIVYKAPKEKYVVTVFTDIT
    CGYCRKLHEEMKEYNDLGITIRYLAFPRHSLQHQSAKDMQSI
    WCSATPNKALDAAFKGDNISPIKSCKNDIAKQYQLGLQFGVQGTPAIVLQDGSVLGGFVPPKALKEDLEQQSE

    >gi|290476430|ref|YP_003469335.1| dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, component of the 2-oxoglutarate dehydrogenase and the pyruvate d
    MSTEIKAQVVVLGAGPAGYSAAFRCADLGLDTVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAQHGIVFGEPQ
    TDIDKIRLWKEKVISQLTGGLGGMAKGRKVNVVNGIGKFTGANTLVVEGEKGATTINFDNAIIAAGSRPIQLPFIPHDDP
    RVWDSTDALELKTVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKSLDAGQAGVAVDERGFIHVDKQMRTNVPHIFAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCAEGMTKLI
    FDKESNRIIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLYESIGMAAEMYEGSITDLPNPKAKKKK

    >gi|290476637|ref|YP_003469542.1| hypothetical protein XBJ1_3660 [Xenorhabdus bovienii SS-2004]
    MSDDAALPLQFTDAAANKVKVLVADEDNPNLRLRVYITGGGCSGFQYGFTFDDQMNEGDLTIQKQGVELVVDPMSLQYLV
    GGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSV

    >gi|290476854|ref|YP_003469765.1| Transcriptional regulator, ArsR family/rhodanese-like domain protein [Xenorhabdus bovienii SS-2004]
    MKTINRTSHALSEMADFAKTLGHSHRLTLIEAIFRHESSVEHLAEISGLSITNTSQHLQQLRRAGFVQTRREGKHVLYRI
    GDGPVANILAALRDYLAYQQTEIQRVVSDSIHHPEHLEGVSIEELLRRQEEGVLLLDVRSEEDYAAGHIPGAINIPTDAL
    VHHLGELPRNQDILAY
    CGGRYCVLSTQAVSLLRSKGFKALRLGDGFPGWQAAGLRVEVSPIRLKKLQ

    >gi|290476993|ref|YP_003469904.1| adenylation of ThiS; with ThiI, thiolation of ThiS; in thiazole synthesis [Xenorhabdus bovienii SS-2004]
    MLNDQEFMRYSRQLLLEDIGSDGQEKLKAGKVLIVGLGGLGSPAALYLAAAGVGHLYLADDDTLHVSNLQRQILYRTADI
    PAGKAVLAAKQLKALNPLVENTVLTERQDRESLENLVRQADLVLDCCDNMATRYAINAACVAENKPLISGSAVGFSGQLI
    VFEPPYLHGCYACLYPDQEEPHRN
    CRTAGVLGPVVGMIGTLQSLEAIKMLVGLPSPLSGKLRLFDGRQQSWSTLQLTLLS
    QCPVCGTHAAKSDRAETISGKTRSGKEVA

    >gi|290477057|ref|YP_003469969.1| periplasmic protein disulfide isomerase I, disulfide bond formation [Xenorhabdus bovienii SS-2004]
    MKTFWLALVGIFMAFNASASGFSEDKQYVELKNPVANQPQVLEFFSFYCPHCYQFENIYHVPSTVEKNLPAGVTHERYHV
    DFIGPLGKDLTDAWAVAIVMKIEDKISPILFEGIQKNHTINSKADIRSAFIKAGVSGEEYDAALNSFIVKSVAAKERQAV
    SSLQLQGVPAIYVNGKYQVKNDGIESTTMAGYAKGFSDVVNYLVTKK

    >gi|290477069|ref|YP_003469981.1| glutathione oxidoreductase, nucleotide-binding [Xenorhabdus bovienii SS-2004]
    MSKHYDYIAIGGGSGGIASMNRAAMYGQKCALIEAKALGGTCVNVGCVPKKVMWHAAQIAESIHQYGPDYGFDTTVNRFD
    WKTLIASRTAYIDRTHQSYERVLGNNKVDVIHGFARFVDAHTVEVNGEKITANHILIATGGRPVCPTIPGAEYGIDSDGF
    FELDEMPKRVAVVGAGYIAVEIAGVLKALGSETHLFVRKHAPLRSFDPLIVETLLEVIKNEGPTLHTEAILKAVIKHADG
    SLTLQLQDGREQTVDTLIWAIGREPMTDNLNLAVTGVELNEKGYIQVDKYQNTNVKGVYAVGDNTGAVELTPVAIAAGRR
    LSERLFNNKPEEHLDYTNVPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYTSSFTAMYTAVTQHRQPCRMKLVCTGADE
    KIVGIHGIGFGMDEILQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|290477079|ref|YP_003469991.1| hypothetical protein XBJ1_4121 [Xenorhabdus bovienii SS-2004]
    MSSLRLAYYDLSPELLQGFRTIKQELEESPLGLALIELIYLRISQINGCAFCLNKHSQSLRENQETERRLSELAGWRVSG
    QFTLREKVALEWTESLTHVVTTHADDYAYLPLKDHFTDKEIADLTFAIALMNGMNRLAIGMRQ

    >gi|290477137|ref|YP_003470052.1| thioredoxin 1, redox factor [Xenorhabdus bovienii SS-2004]
    MNEKIISDRIIHLADADFDAKKLNVKGAVLIEFWAEWCGPCKMIAPILDEVSEEYAGKLTVAKLNVDDHEQTPKAHGIRG
    IPTLMLFKDGEKVATQVGALSKTQLKAFLDSHI

    >gi|290477209|ref|YP_003470126.1| soluble pyridine nucleotide transhydrogenase [Xenorhabdus bovienii SS-2004]
    MQYTHFDAIVIGSGPGGEGAAMGLVKQEKNVAVIERYNSVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRILRS
    SFSEILRHADVVISQQTKMRQGFYERNRCQMFAGEAAFIDEHRVSVRYADGSVDILSADKIIIATGSRPYCPPDVDFTHS
    RIYNSDTILQLDHEPRHVIIYGAGVIGCEYASIFRGLGVKVDLINTRDHLLSFLDQEMSDALSYHFWNSGTVIRHNEEYE
    KIEGLDDGVIVHLKSGKKVKADCLLYANGRTGNTDKLGLENVGLETDSRGLLKVNRVYQSSNENIYAVGDVIGYPSLASA
    AYDQGRIAAKAIMTGSANLHLVEDIPTGIYTIPEISSIGKTEQQLTAMKIPYEVGRAQFKHLARAQIAGMNVGSIKILFH
    RETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF