Xanthomonas oryzae PXO99A uid59131

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|188574309|ref|YP_001911238.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MGFVREYATQAPERSAVDTRAGLQILEFGTDWCGHCMAAQPLLHTLLGGYEAIDYRKIEDGRGRPLGRSFRVTLWPTIIL
    LREGEELARA

    >gi|188574591|ref|YP_001911520.1| organic hydroperoxide resistance protein [Xanthomonas oryzae pv. oryzae PXO99A]
    MASPEKVLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGGDGTNPEQLFAAGYAACFIGAMKAVAAQDKITLPGE
    VSIDSSVGIGQIPGGFGIVVELRIAVPGMDKAELQALVDKAHQV
    CPYSNATRGNIDVTLTLA

    >gi|188574751|ref|YP_001911680.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRALAIKYHVRSIPMLL
    LFKNGEVQATQIGAVGKGQLTQMIDKTLGDAAA

    >gi|188574850|ref|YP_001911779.1| hypothetical protein PXO_03971 [Xanthomonas oryzae pv. oryzae PXO99A]
    MNFEELQAFVGRNPMLSLALVGLTIALIVTEIARLFRGYRALNPAELTRLINSENALVIDLSPTADFEKGHIAGSRNVAM
    AKFDPAGKLLANAKASPVVVV
    CRSGTTSAGAAKTLKKAGFEQVYWLEGGVAAWQMAELPLIKGR

    >gi|188574907|ref|YP_001911836.1| disulphide-isomerase [Xanthomonas oryzae pv. oryzae PXO99A]
    MIAMTLSLRRPSPSSLALLAVLSMLTACDKPAPPAAPSQTHAASTPAPATSIAWREGDVEDAFAEAKESGKPILLYWGAA
    W
    CPPCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGERFGVKAYPTIIVLRTDQSEITRLAGDADNARLAEVLRV
    AAKSTSTAQQLLDKALHTPQQLSADDWAVLGNYAWGTDDRLVKPGDAAHVLTQLSTTAPQPALQRSFALAAISAAEHPPA
    ASAANRALLEAVLANPAEVRTNLSPLSYVPARLITAASNDAGVRTTLSNALNQALDKVYADTSLPISDRLGTAYARIQLA
    RLAQGQPTEAETEGPQPPLPKDVVDTVHQRVTWATDTAKTDEERQSTISTAAALLSDVGDGSGAEQLLLAELPRSRTPYY
    YMPELANLAEQRGDKKTALSWLKKAYDSAQGPATRVQWGVMYVNGLIRLSPDDTAGIESAATQVIGELAGQPDGYRQRTR
    QRFASLGTTLKTWSKQHRQEGSAVLARLQQKMHSSCNSKNASECASWLS

    >gi|188575229|ref|YP_001912158.1| thiol:disulfide interchange protein [Xanthomonas oryzae pv. oryzae PXO99A]
    MKTRFALTLMALLPILVACKAQDGSSDTAPAATTSAAGTAPAPAAAAPATDPAAPPAVGESATTPPPAAPSAAPRAPNGP
    EPVAGTDYLDIDGGQPYQQAAGKIEVAEVFGYV
    CPACNAFQPLIGPWKAGLPSDVHFVYVPAMFGNYWDDYGRAFYAAET
    LGVQEKTHEALYKAIHVDQTLKGEHGKDSVQDIAAFYAKYGVDQKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSLII
    NGKYLVKGQSFPEMLRIADHLIARERATLTK

    >gi|188575230|ref|YP_001912159.1| disulfide oxidoreductase [Xanthomonas oryzae pv. oryzae PXO99A]
    MKLLSRLPLLVLFLLPLLACAADKKAAPVEGEDYTLIDGGQPYAPLAGKVEVTEVFGYTCPHCAHFEPVLEAWVAKQPAY
    VRFTPVPAAFGGFWDAFARAYFAADILGLAKRSHRAMFDAIHEKQTVPTQNVAPEELAAFYASYGIPQQRFIETYKSEAV
    DAKLKAAREFALRSKIPGTPAIIVNGRYLIGARNYPDMLRIADYLIAREHAAPAKR

    >gi|188575419|ref|YP_001912348.1| methionine sulfoxide reductase A [Xanthomonas oryzae pv. oryzae PXO99A]
    MLGIGAFKQRIPRPGEALPGREQALPLHNTHLINGHPLRGEFTGLAQVQFGLGCFWGAERKFWKVPGVYTTAAGYAGGQT
    PNATYSEVCSGQTGHTEAVLVVFDEQAVSFEHLLRTFWESHDPTQGMQQGNDVGTQYRSAIYCTTQAQYAAALASRDAYQ
    QQLTAAGYGAITTEIGFPAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA

    >gi|188575427|ref|YP_001912356.1| alkyl hydroperoxide reductase subunit F [Xanthomonas oryzae pv. oryzae PXO99A]
    MLDANLKTQLTAYLERVTRPIQINASIDESPGSREMLDLLEELVLLSDKISLDIHRDDDQRKPSFALTTPGQDIALRFAG
    LPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGDYRFETYFSLS
    CQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQ
    DEVETRQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNASKRDAAKIAAKGAFDVLVVGGGPAGAAAAVYAARKGIRTGV
    AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYEVDIMNLQRAEQLIPAGADGLIEIKLANGASLKSKTVILS
    TGARWRQMNVPGEDQYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADDVLQRKLR
    SLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGAIQHFDLEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
    GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPATADNVAQAA

    >gi|188575428|ref|YP_001912357.1| alkyl hydroperoxide reductase subunit C [Xanthomonas oryzae pv. oryzae PXO99A]
    MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAAFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAKFPLIGDPAHKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVAN
    NPGQVCPAKWKEGAKTLAPSLDLVGKI

    >gi|188575459|ref|YP_001912388.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MTVRLVRGACALLLPLVLLAACKPASEGTPAAGSGTAPAATTQAPATPADPAAPPNSSVVQQTAEMPKLSLPTVTGETYD
    LAAHRGKWVVVNFWATW
    CAPCLKEMPELSALHTMRGTIEVVGLAYEDITSADMQAFLKDHPVSYPVAILDPYQPPQDFAT
    PRGLPMTYLIGPDGKVAKQFLGPVTARDIEAAVGITGKAG

    >gi|188575658|ref|YP_001912587.1| glutathione S-transferase [Xanthomonas oryzae pv. oryzae PXO99A]
    MRPPLTVHGMSSSGNCYKVRLLLEQLVSRYHWVEVDSVAGQTRTPAYLAKNPNGKVPMVERDDGRVLTESNAILFWLAEG
    TPYLPTNAWQRAQALSWMFFEQYSHEPSVAMARFISLWTPRDAARRAELPQLRVRGEQALALMEQHLQQHAWFTGSDYGI
    ADIALFAYTHCAEDGRFDLERWPAITDWLQRVQALPRFVPMPSAASVTA

    >gi|188575677|ref|YP_001912606.1| 6-O-methylguanine-DNA methyltransferase [Xanthomonas oryzae pv. oryzae PXO99A]
    MSTLHYDTFPSPIGALSVAADDTGVHHILFAQNRYDAIGRARWFHDPDAPLVRAAREQLLDYLHGGRGSFDLPLAPIGTP
    FQLSVWRTLAQIPFGQTWSYAQLAQAVGKPTANRAVGAANGRNPLPIVLP
    CHRVIGANGALTGFGGGLPTKQALLQLEGW
    SPRGGARADDLFAPASALRTG

    >gi|188575852|ref|YP_001912781.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MNRLLPLLGFLLLAALFGFGILWTMQHNPRDVPSPLIGKPAPAFSLPRLDQHEQRVSRDQLLGKPYVLNVFGSWCAECVH
    EHPVLMAQASRLGVPLIGYNYKDVPADATAWLARLGNPYAVVIADEAGQTAIDFGVYGAPETFLIDAQGVIRYKHIGVLT
    PDAIDDELLPAIAALPKGTP

    >gi|188575937|ref|YP_001912866.1| DedA family protein [Xanthomonas oryzae pv. oryzae PXO99A]
    MQGLIEQYGLALVFANVLALSLGLPVPALPTLLLVGASYALQGGSDAWLAGLAALAVSVSASLLGDLAWYLAGRRFGNRT
    LQSLCRLSLSRDSCMKQTERFFSRWGVRVLAVAKFVPGLSLVSVPMAGAMRVRPAAFLRYDAFGASLWALVGLSVGAVFA
    HQVQDVLVFLSELGSGAVVVLAALLACYVGWRWRRYSLLRSLEHARIAVDELVPLLDGEEGLRPTVLDIRAPGYRDLQPY
    MIPGAVFADERQLAQILASVPRDRSVVIY
    CACPDEVSAACLAARMRARGYRDVRPLLGGLDAWRGAGHPVTSLLPVVVVA
    DASIAATA

    >gi|188575943|ref|YP_001912872.1| bacterioferritin comigratory protein [Xanthomonas oryzae pv. oryzae PXO99A]
    MLELPAATFDLPLALSGGTQTTLRGHAGKWLVLYFYPKDSTPGCTTEGLDFNALLPQFKKAGAVVLGVSRDSVKSHDNFC
    AKQGFTFPLISDSDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPDGHVVQEWRKVKVAGHAEAVLAAVKAHAKQ

    >gi|188576130|ref|YP_001913059.1| stringent starvation protein A [Xanthomonas oryzae pv. oryzae PXO99A]
    MTLFSSNDDVLCHRVRLVLAAKGVTYDLVPVDPQNPPGDLIDLNPYHSVPTLVERDLVLYAASVVSEYLDERYPHPPLMP
    IDPLSRARLRLAMLRIEHDWVPQVQAVQLGNKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCAMAPIIWRLDA
    LEISLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDLPG

    >gi|188576175|ref|YP_001913104.1| hypothetical protein PXO_00396 [Xanthomonas oryzae pv. oryzae PXO99A]
    MTQLHFDNRLRQQLPGYQEEGARRREVRAAWSAVMPTPVAAPYLIAHSAEMAHVLGLDASEVASAAFAQVFGGNALYPGM
    QPWAVNYGGHQFGHWAGQLGDGRAISLGEAIGIDGGRYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSESMHHLGVPT
    TRALSLVGTGDAVVRDMFYDGRPQREPGAIVCRVAPSFIRFGNFELPSARGDNALLRQWVDFTIARDFPELVGTAEALYA
    DWFAQVCQRTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLG
    RLAQAVAPLFADQAPLQQGLNRFRDTYLACDRRDTAAKLGLAECRDEDLELIDALRALMRDAEMDMTLTFRGLIDLSPVH
    PDPAQLHDAFYDDHKRVASASQLQEWLQRYAARLQQDALSPDERRALMRLANPRYVLRNYLAQQAIDQAEQGDPSGVQEL
    LEVMRRPYDDQSGRAAFAARRPEWARDRAG
    CSMLSCSS

    >gi|188576319|ref|YP_001913248.1| 3-mercaptopyruvate sulfurtransferase [Xanthomonas oryzae pv. oryzae PXO99A]
    MSADPNWSTLVDAATLAATLQHPQLRLLDARAAPPTAPDPDAAGKAYAQGHLPGAHYADLDHDLADLSRPAHGRHPLPHS
    AAFAKRLGEWGIDPHSQVVVYDAGDGSMAAARAWWMLRLMGHRRAAVLDGGLAAWRAAGFAQSTELPAVHDGAAYPGSFD
    TAAVVDAEQIVERLQQAPGWLLDARAGERFRGDVEPIDPVAGHVPGAVSRPLGLSLRDGRFKPVAELRAELSALLGAYQP
    DQVVVM
    CGSGVTACHLLLALEVAGLSGARVYAGSWSGWLQDASRPVATGS

    >gi|188576347|ref|YP_001913276.1| HesB protein family [Xanthomonas oryzae pv. oryzae PXO99A]
    MTVSLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHITDLAREARDDDAVFEQGGVRIFVDPVSLPLVDGTCIDFG
    KHGLSETFTFSNPNATAECGCGESFTTADEHR

    >gi|188576437|ref|YP_001913366.1| glutathione peroxidase [Xanthomonas oryzae pv. oryzae PXO99A]
    MSDLSTFEFTDLEGRTQTMRDYAGKVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVIGFPCDQFGHQEPGDAAQIRQ
    FCSLDYAVDFPLAEKIEVNGSGAHPLWQWLKHEQRGVLGSEAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALD
    A

    >gi|188576466|ref|YP_001913395.1| arsenate reductase [Xanthomonas oryzae pv. oryzae PXO99A]
    MALTIYHNPACGTSRNTLEMMRQSGEDPEVIEYLQTPPTREKLIELIAAMGIAPRALLRQKGTPYVELGLDNPALTDEQL
    VDAMMAYPILINRPIVVSDRGVALCRPSEKVLALLDSPVASFTKEDGETVTTGGAST

    >gi|188576512|ref|YP_001913441.1| hypothetical protein PXO_00583 [Xanthomonas oryzae pv. oryzae PXO99A]
    MNAQLTQELPEFPTWLNARPSTLQEHRGRALVLAFVNASSVWCAERLAELAHWQARSPGRLQLIVVQVPRFDSERVPQRA
    LKQLRGHGVSAPILLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDLDKALTALCEGQQPPSDADLYGVAERDP
    EPHLALRFPTGLAATEDLLYVADTGHHRVLECTHSGRVLRQFGHGNADLIDGGVGEAAFRRPQGLALERDQLYVADTGNH
    ALRRINLRSGQVDTLCGTGRSGEPVEGPLASASASALNYPQGLAIADNQVLIAMAGDNRIWSYHLGRAALTARAGTGALE
    TRDGSGHLAAFAQPAGLASVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGTWQFGDQDGPRSTARVQFPQAIALAADS
    PLLWIADTGNGRLRCLRLGGGDLTTVELPRRLHGPAGLAVAAGAVWIAETDAHAILRYDLASGALSDVSIDE

    >gi|188576674|ref|YP_001913603.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MGAIVLLLALAALLVYAVVRSGQDDRDALPSALIGKPAPEFALPLLHDPSIVVHARELRGAPYIINVWGSWCPACREEHP
    VLSRFALTKRVRVIGYNWKDERNDALRWLEQLGNPYLLVVADQDGRTAIDFGIAAAPETFLIDGRGVVRWKYSGMLTQSI
    IDTQLIPALSKIERSPTAAPDLHAKQ

    >gi|188576695|ref|YP_001913624.1| molybdopterin biosynthesis protein MoeB [Xanthomonas oryzae pv. oryzae PXO99A]
    MSSHDISPADARARALQGALLIDIRQLHERASGQAEGALAIAQNALETEPATHLPEHAREIVLICQRGKRSAHTAAILRA
    HGYARVASVAGGTSAWASDGLPLVRPTLPPDEQDFLERYSRHLRLSQVGVEGQRRLARARVLLVGAGGLGSPAAFYLAAA
    GVGHLSIADDDVVDRSNLQRQILHTEDSVGTAKVDSAAQRIAALNPRVGIEAVQTRVTADNVEALLQDVDVVVDGADNFP
    ARYLLNDACVKRGKPLVYGAVQQFEGQVSVFDAGRNRGRAPCYRCLFPEPPPPEFAPS
    CAEAGVLGVLPGVIGLLQATEV
    IKLLLGIGDSLTGRLLSFDALAMRFRDIRLPPDPHCTVCAPGVVFGGYADYAAFCARAC

    >gi|188576731|ref|YP_001913660.1| thioredoxin-disulfide reductase [Xanthomonas oryzae pv. oryzae PXO99A]
    MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMTRMQAHAER
    FETEVIFDHIHTADLSQRPFRLTGDGAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIDEVLGNDAGVTGVRVKSTIDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDK
    SA

    >gi|188576865|ref|YP_001913794.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MGAIVLLLALAALLVYAVVRSGQDDRDALPSALIGKPAPEFALPLLHDPSIVVHARELRGAPYIINVWGSWCPACREEHP
    VLSRFALTKRVRVIGYNWKDERNDALRWLEQLGNPYLLVVADQDGRTAIDFGIAAAPETFLIDGRGVVRWKYSGMLTQSI
    IDTQLIPALSKIERSPTAAPDLHAKQ

    >gi|188576886|ref|YP_001913815.1| molybdopterin biosynthesis protein MoeB [Xanthomonas oryzae pv. oryzae PXO99A]
    MSSHDISPADARARALQGALLIDIRQLHERASGQAEGALAIAQNALETEPATHLPEHAREIVLICQRGKRSAHTAAILRA
    HGYARVASVAGGTSAWASDGLPLVRPTLPPDEQDFLERYSRHLRLSQVGVEGQRRLARARVLLVGAGGLGSPAAFYLAAA
    GVGHLSIADDDVVDRSNLQRQILHTEDSVGTAKVDSAAQRIAALNPRVGIEAVQTRVTADNVEALLQDVDVVVDGADNFP
    ARYLLNDACVKRGKPLVYGAVQQFEGQVSVFDAGRNRGRAPCYRCLFPEPPPPEFAPS
    CAEAGVLGVLPGVIGLLQATEV
    IKLLLGIGDSLTGRLLSFDALAMRFRDIRLPPDPHCTVCAPGVVFGGYADYAAFCARAC

    >gi|188576922|ref|YP_001913851.1| thioredoxin-disulfide reductase [Xanthomonas oryzae pv. oryzae PXO99A]
    MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMTRMQAHAER
    FETEVIFDHIHTADLSQRPFRLTGDGAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIDEVLGNDAGVTGVRVKSTIDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDK
    SA

    >gi|188577071|ref|YP_001914000.1| ABC transporter vitamin B12 uptake permease [Xanthomonas oryzae pv. oryzae PXO99A]
    MLLNRLLVIVFIGFFAKSAFAAGTPVLDVDYRPLAGKTPINLNLTYGGKVVMVVNTASKCGYTPQYEGLEALNQRFASRG
    FTVLGFPSNDFHGQEPGSEKQIQEFCTLTYGVKFPMFEKVHVLGAEATPLYQRLTQATGVAPGWNFHKYLIGRDGRVVAQ
    FPSKIKPDDPSVLAAIERELKAPSR

    >gi|188577097|ref|YP_001914026.1| dihydrolipoamide dehydrogenase [Xanthomonas oryzae pv. oryzae PXO99A]
    MAENYDVVVIGAGPAGYHAAIRAAQLGMKVACIDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHLFGDHGIS
    FNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIALKGTNVILAAGSESIELPF
    AKFDGDTIVDNVGGLDFTAVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALTDAEVAKTALKEFKKQGLDIK
    LGAKVGKTEITGSGDAKQVLLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLAEGTGVKVTDRGQIEVDGHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAM
    GEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFNGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN

    >gi|188577151|ref|YP_001914080.1| ArsC family protein [Xanthomonas oryzae pv. oryzae PXO99A]
    MTTLYGLKKCDTCKKATKWLDRFGVAYTFVDYREHKPEPETLVAWADQAGGFDALINKSSTTWRQLPDNKKTPGSQAEWK
    LLLREYPQLIRRPLVVTDDGALSQGFSDNGFKKRFGIE

    >gi|188577275|ref|YP_001914204.1| polyketide synthase [Xanthomonas oryzae pv. oryzae PXO99A]
    MPTNESPLLRIDIWSDVVCPWCWIGKRRFQSAIAALGAQAPVLDIHYHAFQLDPEAGLEPTPLRDALALKFGGTARVEQM
    LAQPQATAQAEGLPLDFDRGQVQVSTLRAHRLIWLASHEGDVDAVMEALFHAHFTEGHNVGAIETLVHAGEAGGLAAARV
    QAMLESEEGIVEVHAQLAQAAALGIRAVPSFVINGRALIQGAQPPESVAQALP

    >gi|188577669|ref|YP_001914598.1| putative glutaredoxin-like protein [Xanthomonas oryzae pv. oryzae PXO99A]
    MLVMERIQAEVEQHPIVLFMKGTPQFPMCEFSSRAVQALVAAGADQLRTINVLEEPEVRANLPRYSNWPTFPQLFIHGEL
    IGGCDITLELFEVGELKRIVSEAYQP

    >gi|188577788|ref|YP_001914717.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MSDKPHVFDATTDTFETEVLHKSLTTPVLVDFWAAWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQIAAAFQIRSV
    PTVFLVKGGEIVDGFPGAMPEGQVREFLTQHGVLPAEPQVAEEVPLAPLDPQAQAAALREAIAAQPDKDELKLDLALALL
    KTGDTAEAEQLIDALPANLATDDRAVRAKARLSFANVLKDAPDAGTLQATVDANGADLRARHLLGVRHLLDGNDEAALEQ
    FLEMLRQDRTFDDNRPRRSLIDAFRVIEDEDLVGRYRRKMSALVF

    >gi|188577952|ref|YP_001914881.1| hypothetical protein PXO_02028 [Xanthomonas oryzae pv. oryzae PXO99A]
    MLCAPGACTAITVSLVAARKQWPLTAVHVHLHDTQRGAAGMAITREIVLDGALDDEQRARLIEVADTWFFSRLRGARRTL
    RPVRMPTAPSAQ

    >gi|188577971|ref|YP_001914900.1| peroxiredoxin OsmC [Xanthomonas oryzae pv. oryzae PXO99A]
    MGISRHATAHWEGDLKTGKGQLSTPQSGVMDNTRYAFSSRFGDEKGTNPEELIAAAHAGCFTMALSAQLTEAGFPPTSLD
    TRADVDLSMEGGPQLSQIRLKLKAVVPGIDEATFRELADTAKKN
    CPVSKALSAVPISLETEFSS

    >gi|188578315|ref|YP_001915244.1| putative glutaredoxin-like protein, putative [Xanthomonas oryzae pv. oryzae PXO99A]
    MSLDPALRSRIDTLLQSSRVVLFMKGQPGMPQCGFSAKAVGVLDGLGIDYAHVNVLADQEIREGIKVYGDWPTIPQLYVD
    GELIGGSDIILQMADSGELSSMLGLQAPDRTPPKITITPAAVEMLKGALADAPDASLTLSIDANFQPNFQLAPTNPNAIA
    AESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPNAPKPVQELSVRDADDRLKAGSLTLVDVRPADERALASVAA
    PFRTLDAHERAAIEQLPKDTALAFL
    CHRGGRSLQAAEHFRSLGFTNVYNVTGGIDAWSDDVDNGVAKY

    >gi|188578325|ref|YP_001915254.1| arsenate reductase [Xanthomonas oryzae pv. oryzae PXO99A]
    MHVYLITTFLVGGCWLTLHQATMHAVIYHNPGCGTSRNTLALIRHTGVEPQIVDYLQHPPSRETLQSLIAAAGITVREAI
    RQKGSPYLELGLDDPALDDTALLSAMLAHPILINRPFVQTPLGTRLCRPSELVLDLLPPATRGFVKEDGESLLDEAGQRI
    RR

    >gi|188578381|ref|YP_001915310.1| carboxymuconolactone decarboxylase [Xanthomonas oryzae pv. oryzae PXO99A]
    MSGSDEGSADRLREFTEFRQRMNQRILTEPNQVVRRFFALDTQTYQAGTLDVKTKELLGLVASMVLRCDDCISYHVAQCK
    EAGVSREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLESGAQAPAPHAHD

    >gi|188578382|ref|YP_001915311.1| glutaredoxin 3 [Xanthomonas oryzae pv. oryzae PXO99A]
    MSQDHTDQGAASGPQITLYSSAICPYCVAAKNFLKSKGKTWTEVRIDLDPAERDKMVALAKRTSVPQIFVGDVHVGGYDD
    MMAMHRAGKLEQLLAGSAGGQA

    >gi|188578442|ref|YP_001915371.1| disulfide bond formation protein B [Xanthomonas oryzae pv. oryzae PXO99A]
    MNPFRWSFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFAALAVFFLIGALHGPRAAGARKVYGVLSFIAA
    GVGMGIGARHVWVQIRPKDMMSS
    CGPPLSFLSETMGPFEVFRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALS
    AGFKARRSSLHH

    >gi|188578525|ref|YP_001915454.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MTIHVAERIPEIVLKRMRDGIEAVDTHTLFAGRTVLLFAVPGAFTPTCSAKHLPGYVEHFDALRKRGIEVRCTAVNDPFV
    MPAWGRNPLIPDGLHLLPDGNPELARAPDLEIDASGSGMGLRSRCYALYADDAVVEALFVEEPGEFKVSAADHVLQHLLD


    >gi|188578601|ref|YP_001915530.1| disulfide isomerase [Xanthomonas oryzae pv. oryzae PXO99A]
    MYRLAIAALLGAISLTACAQSSQPAASTVGAKPAAAPAAAGNVDQRVSTALKALDPDFKPDYLGAAPFPGFREVVVGGQV
    LYVSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTVPKADRIVFAPANPKYTVTVFTDVE
    CGYCRKLHSEIGELNK
    QGIAVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQL
    GGYLPPAQLREALEKRAVATAGGSR

    >gi|188578721|ref|YP_001915650.1| dihydrolipoamide dehydrogenase [Xanthomonas oryzae pv. oryzae PXO99A]
    MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVAKDQGLVTLESDKATLEVPSSAAGVVKELKVKVGDILSEGALVLLLETEG
    EAAAPAKAETKAAPAAVAPAAAPGSKPPVTPSHRAPAEPAPSKPALASDKPADIACKMVVLGAGPGGYTAAFRAADLGLD
    TVLIERYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVDFGQPKITLGTLREYKEKVVGKLTGGLASMAKQRKVR
    TVTGVATFVSPNELEIVGDDGKTQLLRFEHCIIAAGSQAVKLPNFPWDDKRVMDSTDALELHDIPKTLLVVGGGIIGLEM
    ATVYSALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGVDVHLKTKATDVTASKKGITVSFEAAVEGDKPGLQATAYD
    RVLVAVGRSPNGKKIGADKAGVTVTERGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAGEKKEWVAR
    VIPSVAYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEETHRVIGGAIVGVHAGDLLAEI
    GLAIEMGAEAEDIGHTIHAHPTLSESVGMAAEVYDGTITDLYIPKKK

    >gi|188578751|ref|YP_001915680.1| methionine sulfoxide reductase B [Xanthomonas oryzae pv. oryzae PXO99A]
    MSQFDLTPPSPAQRDALIAGLSDEEQRVLLQHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSSAKFESGTGWPSFFAPY
    DPAHVREIRDTSYGMIRTEIVCARCDSHLGHVFPDGPPPTGERH
    CLNSVSLGFTENGQALPNPLHREGAEAQSA

    >gi|188578809|ref|YP_001915738.1| C-type cytochrome biogenesis protein [Xanthomonas oryzae pv. oryzae PXO99A]
    MFAASLVLSPAPAQAAVTEADLLPVDQAFVLSATADSRDRIALNWKIAPGYYLYRHRISVKSAQGFAAGELALPEGESKH
    DEFFGQVQTYRKQLRASLAGKADPAVQTAVLQVQYQGCADAGVCYPPQRREIRVNLPAAEAAGTPGAAPQRENLGALVPR
    SAAGPRLFGTPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRFTPAPGYYIYRDRTSLALEGTGGVRTGLPRWPQGKAH
    RDEHFGDVVVYFDQAEVTLPLLRDKPDPAHATLVATFQGCQTDGICYPPMTRRVTLDVPAGTVSPQNQAQAAPLMISPLA
    AGQVPVDPAPAAAPASAAGPVADASAGNPERTSPPHTDKGLLGMLVLALLGGLVLNLMPCVLPILSLKVLGLAHSGESRG
    HARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALAYLMFAVGLSLSGVFTLGTNLGGIGQSLATR
    NGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPALLAMLVFLALGLGLALPFLLIGFVPSLARRLPTPGAWMETLKQ
    VLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWCFERSRWKSHRLGMGLATVMLVLALVPVVAVTRLSLPAA
    TAAEGGVAFSPQLLDRMRADNRVVFVNMTADW
    CVTCKANEKNVLSSAEFRDALRRVDAVYMKGDWTNVDPAISTFLDQHQ
    AVGVPLYVVYGPGAPPAILPTVLTGAITEDALLRAAR

    >gi|188578868|ref|YP_001915797.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas oryzae pv. oryzae PXO99A]
    MAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFDENRAEDDLAVVTDGVTLLVDPLSLQYLMGAEVDYTESLTG
    AQFVIRNPNAKTTCGCGSSFSV

    >gi|188578918|ref|YP_001915847.1| thioredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
    MQTLHATTPDDYAAALAAHPRLLVDYYKDNCPGCKMLDMSLTKFAASEDAAGVALLKVKLEVVGEEFFRDLGLRQTPTLA
    LFKDGAEVVRLPGFQSPAQVEAAVRSGL

    >gi|188579196|ref|YP_001916125.1| glutathione peroxidase [Xanthomonas oryzae pv. oryzae PXO99A]
    MNQTLYDIPVTRIEGGPATLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRAQGLEVLAFPANDFNGQEPGSEAEIA
    QFCRLTYDVTFPMFAKIAVTGEQAHPLYQALTSTHPHTTGDGPMREKLAGYGIAPNPAPGVLWNFEKFLIGRDGKIIDRF
    APDIPADDARLLQAIDAALVV