Xanthomonas oryzae MAFF 311018 uid58547

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|84621789|ref|YP_449161.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MGFVREYATQAPERSAVDTRAGLQILEFGTDWCGHCMAAQPLLHTLLGGYEAIDYRKIEDGRGRPLGRSFRVTLWPTIIL
    LREGEELARA

    >gi|84622100|ref|YP_449472.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MQTLHATTPDDYAAALAAHPRLLVDYYKDNCPGCKMLDMSLTKFAASEDAAGVALLKVKLEVVGEEFFRDLGLRQTPTLA
    LFKDGAEVVRLPGFQSPAQVEAAVRSGL

    >gi|84622145|ref|YP_449517.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSTLVSLPTAAPAPDYQSIDRPLHFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFDENRAEDDLAVVTDG
    VTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV

    >gi|84622181|ref|YP_449553.1| C-type cytochrome biogenesis protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MKSLSRWIARCALLAAPVFAASLVLSPAPAQAAVTEADLLPVDQAFVLSATADSRDRIALNWKIAPGYYLYRHRISVKSA
    QGFAAGELALPEGESKHDEFFGQVQTYRKQLRASLAGKADPAVQTAVLQVQYQGCADAGVCYPPQRREIRVNLPAAEAAG
    TPGAAPQRENLGALVPRSAAGPRLFGTPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRFTPAPGYYIYRDRTSLALEG
    TGGVRTGLPRWPQGKAHRDEHFGDVVVYFDQAEVTLPLLRDKPDPAHATLVATFQGCQTDGICYPPMTRRVTLDVPAGTV
    SPQNQAQAAPLMISPLAAGQVPVDPAPAAAPASAAGPVADASAGNPERTSPPHTDKGLLGMLVLALLGGLVLNLMPCVLP
    ILSLKVLGLAHSGESRGHARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALAYLMFAVGLSLSGV
    FTLGTNLGGIGQSLATRNGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPALLAMLVFLALGLGLALPFLLIGFVPS
    LARRLPTPGAWMETLKQVLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWCFERSRWKSHRLGMGLATVMLV
    LALVPVVAVTRLSLPAATAAEGGVAFSPQLLDRMRADNRVVFVNMTADW
    CVTCKANEKNVLSSAEFRDALRRVDAVYMKG
    DWTNVDPAISTFLDQHQAVGVPLYVVYGPGAPPAILPTVLTGAITEDALLRAAR

    >gi|84622284|ref|YP_449656.1| methionine sulfoxide reductase B [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSQFDLTPPSPAQRDALIAGLSDEEQRVLLQHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSSAKFESGTGWPSFFAPY
    DPAHVREIRDTSYGMIRTEIVCARCDSHLGHVFPDGPPPTGERH
    CLNSVSLGFTENGQALPNPLHREGAEAQSA

    >gi|84622315|ref|YP_449687.1| dihydrolipoamide dehydrogenase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVAKDQGLVTLESDKATLEVPSSAAGVVKELKVKVGDILSEGALVLLLETEG
    EAAAPAKAETKAAPAAVAPAAAPGSKPPVTPSHRAPAEPAPSKPALASDKPADIACKMVVLGAGPGGYTAAFRAADLGLD
    TVLIERYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVDFGQPKITLGTLREYKEKVVGKLTGGLASMAKQRKVR
    TVTGVATFVSPNELEIVGDDGKTQLLRFEHCIIAAGSQAVKLPNFPWDDKRVMDSTDALELHDIPKTLLVVGGGIIGLEM
    ATVYSALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGVDVHLKTKATDVTAGKKGITVSFEAAVEGDKPGLQATAYD
    RVLVAVGRSPNGKKIGADKAGVTVTERGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAGEKKEWVAR
    VIPSVAYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEETHRVIGGAIVGVHAGDLLAEI
    GLAIEMGAEAEDIGHTIHAHPTLSESVGMAAEVYDGTITDLYIPKKK

    >gi|84622422|ref|YP_449794.1| disulfide isomerase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MYRLAIAALLGAISLTACAQSSQPAASTVGAKPAAAPAAAGNVDQRVSTALKALDPDFKPDYLGAAPFPGFREVVVGGQV
    LYVSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTVPKADRIVFAPANPKYTVTVFTDVE
    CGYCRKLHSEIGELNK
    QGIAVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQL
    GGYLPPAQLREALEKRAVATAGGSR

    >gi|84622490|ref|YP_449862.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MTIHVAERIPEIVLKRMRDGIEAVDTHTLFAGRTVLLFAVPGAFTPTCSAKHLPGYVEHFDALRKRGIEVRCTAVNDPFV
    MPAWGRNPLIPDGLHLLPDGNPELARAPDLEIDASGSGMGLRSRCYALYADDAVVEALFVEEPGEFKVSAADHVLQHLLD


    >gi|84622551|ref|YP_449923.1| disulfide bond formation protein B [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MNPFRWSFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFAALAVFFLIGALHGPRAAGARKVYGVLSFIAA
    GVGMGIGARHVWVQIRPKDMMSS
    CGPPLSFLSETMGPFEVFRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALS
    AGFKARRSSLHH

    >gi|84622645|ref|YP_450017.1| glutaredoxin-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSLDPALRSRIDTLLQSSRVVLFMKGQPGMPQCGFSAKAVGVLDGLGIDYAHVNVLADQEIREGIKVYGDWPTIPQLYVD
    GELIGGSDIILQMADSGELSSMLGLQAPDRTPPKITITPAAVEMLKGALADAPDASLTLSIDANFQPNFQLAPTNPNAIA
    AESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPNAPKPVQELSVRDADDRLKAGSLTLVDVRPADERALASVAA
    PFRTLDAHERAAIEQLPKDTALAFL
    CHRGGRSLQAAEHFRSLGFTNVYNVTGGIDAWSDDVDNGVAKY

    >gi|84622969|ref|YP_450341.1| osmotically inducible protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MGISRHATAHWEGDLKTGKGQLSTPQSGVMDNTRYAFSSRFGDEKGTNPEELIAAAHAGCFTMALSAQLTEAGFPPTSLD
    TRADVDLSMEGGPQLSQIRLKLKAVVPGIDEATFRELADTAKKN
    CPVSKALSAVPISLETEFSS

    >gi|84622992|ref|YP_450364.1| hypothetical protein XOO_1335 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MLCAPGACTAITVSLVAARKQWPLTAVHVHLHDTQRGAAGMAITREIVLDGALDDEQRARLIEVADTWFFSRLRGARRTL
    RPVRMPTAPSAQ

    >gi|84623068|ref|YP_450440.1| glutathione S-transferase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSTVRPPLTVHGMSSSGNCYKVRLLLEQLVSRYHWVEVDSVAGQTRTPAYLAKNPNGKVPMVERDDGRVLTESNAILFWL
    AEGTPYLPTNAWQRAQALSWMFFEQYSHEPSVAMARFISLWTPRDAARRAEPPQLRVRGEQALALMEQHLQQHAWFTGSD
    YGIADIALFAYTHCAEDGRFDLERWPAITDWLQRVQALPRFVPMPSAASVTA

    >gi|84623085|ref|YP_450457.1| 6-O-methylguanine-DNA methyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSTLHYDTFPSPIGALSVAADDTGVHHILFAQNRYDAIGRARWLHDPDAPLVCAAREQLLDYLHGGRGSFDLPLAPIGTP
    FQLSVWRTLAQIPFGQTWSYAQLAQAVGKPTANRAVGAANGRNPLPIVLP
    CHRVIGANGALTGFGGGLPTKQALLQLEGW
    SPRGGARADDLFAPASALRTG

    >gi|84623416|ref|YP_450788.1| polyketide synthase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MPTNESPLLRIDIWSDVVCPWCWIGKRRFQSAIAALGAQAPVLDIHYHAFQLDPEAGLEPTPLRDALALKFGGTARVEQM
    LAQPQATAQAEGLPLDFDRGQVQVSTLRAHRLIWLASHEGDVDAVMEALFHAHFTEGHNVGAIETLVHAGEAGGLAAARV
    QAMLESEEGIVEVHAQLAQAAALGIRAVPSFVINGRALIQGAQPPESVAQALLQLAAESTPVGGPDACGPDGCAV

    >gi|84623535|ref|YP_450907.1| hypothetical protein XOO_1878 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MTTLYGLKKCDTCKKATKWLDRFGVAYTFVDYREHKPEPETLVAWADQAGGFDALINKSSTTWRQLPDNKKTPGSQAEWK
    LLLREYPQLIRRPLVVTDDGALSQGFSDNGFKKRFGIE

    >gi|84623580|ref|YP_450952.1| dihydrolipoamide dehydrogenase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MAENYDVVVIGAGPAGYHAAIRAAQLGMKVACIDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHLFGDHGIS
    FNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIALKGTNVILAAGSESIELPF
    AKFDGDTIVDNVGGLDFTAVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALTDAEVAKTALKEFKKQGLDIK
    LGAKVGKTEITGSGDAKQVLLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLAEGTGVKVTDRGQIEVDGHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAM
    GEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFNGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN

    >gi|84623601|ref|YP_450973.1| ABC transporter vitamin B12 uptake permease [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MLLNRLLVIVFIGFFAKSAFAAGTPVLDVDYRPLAGKTPINLNLTYGGKVVMVVNTASKCGYTPQYEGLEALNQRFASRG
    FTVLGFPSNDFHGQEPGSEKQIQEFCTLTYGVKFPMFEKVHVLGAEATPLYQRLTQATGVAPGWNFHKYLIGRDGRVVAQ
    FPSKIKPDDPSVLAAIERELKAPSR

    >gi|84623675|ref|YP_451047.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MVESRSPRLPTAVLVGAIVLLLALAALLVYAVVRSGQDDRDALPSALIGKPAPEFALPLLHDPSIVVHARELRGAPYIIN
    VWGSW
    CPACREEHPVLSRFALTKRVRVIGYNWKDERNDALRWLEQLGNPYLLVVADQDGRTAIDFGIAAAPETFLIDGRG
    VVRWKYSGMLTQSIIDTQLIPALSKIERSPTAAPDLHAKQ

    >gi|84623828|ref|YP_451200.1| hypothetical protein XOO_2171 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MAAGRRSRAPDLGQTHPRLIALGHNHRMNAQLTQELPEFPTWLNARPSTLQEHRGRALVLAFVNASSVWCAESLAELAHW
    QARSPGRLQLIVVQVPRFDSERVPQRALKQLRGHGVSAPILLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDL
    DKALTALCEGQQPPSDADLYGVAERDPEPHLALRFPTGLAATEDLLYVADTGHHRVLECTHSGRVLRQFGHGNADLIDGG
    VGEAAFRRPQGLALERDQLYVADTGNHALRRINLRSGQVDTLCGTGRSGEPVEGPLASASASALNYPQGLAIADNQVLIA
    MAGDNRIWSYHLGRAALTARAGTGALETRDGSGHLAAFAQPAGLASVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGT
    WQFGDQDGPRSTARVQFPQAIALAADSPLLWIADTGNGRLRCLRLGGGDLTTVELPRRLHGPAGLAVAAGAVWIAETDAH
    AILRYDLASGALSDVSIDE

    >gi|84623876|ref|YP_451248.1| glutathione peroxidase-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSDLSTFEFTDLEGRTQTMRDYAGKVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVIGFPCDQFGHQEPGDAAQIRQ
    FCSLDYAVDFPLAEKIEVNGSGAHPLWQWLKHEQRGVLGSEAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALD
    A

    >gi|84623952|ref|YP_451324.1| hypothetical protein XOO_2295 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MTVSLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHIIDLAREARDDDAVFEQGGVRIFVDPVSLPLVDGTCIDFG
    KHGLSETFTFSNPNATAECGCGESFTTADEHR

    >gi|84623977|ref|YP_451349.1| thiosulfate sulfurtransferase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSADPNWSTLVDAATLAATLQHPQLRLLDARAAPPTAPDPDAAGKRYAQGHLPGAHYADLDHDLADLSRPAHGRHPLPHS
    AAFAKRLGEWGIDPHSQVVVYDAGDGSMAAARAWWMLRLMGHRRAAVLDGGLAAWRAAGFAQSTELPAVHDGAAYPGSFD
    TAAVVDAEQIVERLQQAPGWLLDARAGERFRGDVEPIDPVAGHVPGAVSRPLGLSLRDGRFKPVAELRAELSALLGAYQP
    DQVVVM
    CGSGVTACHLLLALEVAGLSGARVYAGSWSGWLQNASRPVATGS

    >gi|84624035|ref|YP_451407.1| molybdopterin biosynthesis protein MoeB [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSSHDISPADARARALQGALLIDIRQLHERASGQAEGALAIAQNALETEPATHLPEHAREIVLICQRGKRSAHTAAILRA
    HGYARVASVAGGTSAWASDGLPLVRPTLPPDEQDFLERYSRHLRLSQVGVEGQRRLARARVLLVGAGGLGSPAAFYLAAA
    GVGHLSIADDDVVDRSNLQRQILHTEDSVGTAKVDSAAQRIAALNPRVGIEAVQTRVTADNVEALLQDVDVVVDGADNFP
    ARYLLNDACVKRGKPLVYGAVQQFEGQVSVFDAGRNRGRAPCYRCLFPEPPPPEFAPS
    CAEAGVLGVLPGVIGLLQATEV
    IKLLLGIGDSLTGRLLSFDALAMRFRDIRLPPDPHCTVCAPGVVFGGYADYAAFCARAC

    >gi|84624063|ref|YP_451435.1| thioredoxin reductase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMTRMQAHAER
    FETEVIFDHIHTADLSQRPFRLTGDGAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIDEVLGNDAGVTGVRVKSTIDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDK
    SA

    >gi|84624220|ref|YP_451592.1| hypothetical protein XOO_2563 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MTQLHFDNRLRQQLPGYQEEGARRREVRAAWSAVMPTPVAAPYLIAHSAEMAHVLGLDASEVASAAFAQVFGGNALYPGM
    QPWAVNYGGHQFGHWAGQLGDGRAISLGEAIGIDGGRYELQLKGAGPTPYSRGADGRAVLRSSIREFLCSESMHHLGVPT
    TRALSLVGTGDAVVRDMFYDGRPQREPGAIVCRVAPSFIRFGNFELPSARGDNALLRQWVDFTIARDFPELVGTAEALYA
    DWFAQVCQRTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLG
    RLAQAMAPLFADQAPLQQGLNRFRDTYLACDRRDTAAKLGLAECRDEDLELIDALRALMRDAEMDMTLTFRGLIDLSPVH
    PDPAQLHDAFYDDHKRVASASQLQEWLQRYAARLQQDALSPDERRALMRLANPRYVLRNYLAQQAIDQAEQGDPSGVQEL
    LEVMRRPYDDQSGRAAFAARRPEWARDRAG
    CSMLSCSS

    >gi|84624256|ref|YP_451628.1| stringent starvation protein A [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVPVDPQNPPGDLIDLNPYHSVPTLVERDLVLYAASVVSEYLD
    ERYPHPPLMPIDPLSRARLRLAMLRIEHDWVPQVQAVQLGNKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCA
    MAPIIWRLDALEISLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDLPG

    >gi|84624434|ref|YP_451806.1| bacterioferritin comigratory protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MTDAMLELPAATFDLPLALSGGTQTTLRGHAGKWLVLYFYPKDSTPGCTTEGLDFNALLPQFKKAGAVVLGVSRDSVKSH
    DNFCAKQGFTFPLISDSDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPDGHVVQEWRKVKVAGHAEAVLAAVKAHAKQ


    >gi|84624439|ref|YP_451811.1| hypothetical protein XOO_2782 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MQGLIEQYGLALVFANVLALSLGLPVPALPTLLLVGASYALQGGSDAWLAGLAALAVSVSASLLGDLAWYLAGRRFGNRT
    LQSLCRLSLSRDSCMKQTERFFSRWGVRVLAVAKFVPGLSLVSVPMAGAMRVRPAAFLRYDAFGASLWALVGLSVGAVFA
    HQVQDVLVFLSELGSGAVVVLAALLACYVGWRWRRYSLLRSLEHARIAVDELVPLLDGEEGLRPTVLDIRAPGYRDLQPY
    MIPGAVFADERQLAQILASVPRDRSVVIY
    CACPDEVSAACLAARMRARGYRDVRPLLGGLDAWRGAGHPVTSLLPVVVVA
    DASIAATA

    >gi|84624518|ref|YP_451890.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MNRLLPLLGFLLLAALFGFGILWTMQHNPRDVPSPLIGKPAPAFSLPRLDQHEQRVSRDQLLGKPYVLNVFGSWCAECVH
    EHPVLMAQASRLGVPLIGYNYKDVPADATAWLARLGNPYAVVIADEAGQTAIDFGVYGAPETFLIDAQGVIRYKHIGVLT
    PDAIDDELLPAIAALPKGTP

    >gi|84624697|ref|YP_452069.1| hypothetical protein XOO_3040 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MLVMERIQAEVEQHPIVLFMKGTPQFPMCEFSSRAVQALVAAGADQLRTINVLEEPEVRANLPRYSNWPTFPQLFIHGEL
    ISGCDITLELFEVGELKRIVSEAYQP

    >gi|84624801|ref|YP_452173.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSDKPHVFDATTDTFETEVLHKSLTTPVLVDFWAVWCGPCKSLTPILEKLAGEYNGAFELGKVDVDKEQQIAAAFQIRSV
    PTVFLVKGGEIVDGFPGAMPEGQVREFLTQHGVLPAEPQVAEEVPLAPLDPQAQAAALREAIAAQPDKDELKLDLALALL
    KTGDTAEAEQLIDALPANLATDDRAVRAKARLSFANVLKDAPDAGTLQATVDANGADLRARHLLGVRHLLDGNDEAALEQ
    FLEMLRQDRTFDDNRPRRSLIDAFRVIEDEDLVGRYRRKMSALVF

    >gi|84625073|ref|YP_452445.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MTVRLVRGACALLLPLVLLAACKPASEGTPAAGSGTAPAATTQAPATPADPAAPPNSSVVQQTAEMPKLSLPTVTGETYD
    LAAHRGKWVVVNFWATW
    CAPCLKEMPELSALHTMRDTIEVVGLAYEDITSADMQAFLKDHPVSYPVAILDPYQPPQDFAT
    PRGLPMTYLIGPDGKVAKQFLGPVTARDIEAAVGITGKAG

    >gi|84625104|ref|YP_452476.1| alkyl hydroperoxide reductase subunit C [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAAFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAKFPLIGDPAHKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVAN
    NPGQVCPAKWKEGAKTLAPSLDLVGKI

    >gi|84625105|ref|YP_452477.1| alkyl hydroperoxide reductase subunit F [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MLDANLKTQLTAYLERVTRPIQINASIDESPGSREMLDLLEELVLLSDKISLDIHRDDDQRKPSFALTTPGQDIALRFAG
    LPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGDYRFETYFSLS
    CQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQ
    DEVETRQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNASKRDAAKIAAKGAFDVLVVGGGPAGAAAAVYAARKGIRTGV
    AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYEVDIMNLQRAEQLIPAGADGLIEIKLANGASLKSKTVILS
    TGARWRQMNVPGEDQYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADDVLQRKLR
    SLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGAIQHFDLEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
    GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPATADNVAQAA

    >gi|84625112|ref|YP_452484.1| methionine sulfoxide reductase A [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MLGIGAFKQRIPCPGEALPGREQALPLHNTHLINGHPLRGEFTGLAQVQFGLGCFWGAERKFWKVPGVYTTAAGYAGGQT
    PNATYSEVCSGQTGHTEAVLVVFDEQAVSFEHLLRTFWESHDPTQGMQQGNDVGTQYRSAIYCTTQAQYAAALASRDAYQ
    QQLTAAGYGAITTEIGFPAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA

    >gi|84625117|ref|YP_452489.1| hypothetical protein XOO_3460 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSGSDEGSADRLREFTEFRQRMNQRILAEPNQVVRRFFALDTQTYQAGTLDVKTKELLGLVASMVLRCDDCISYHVAQCK
    EAGVSREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLESGAQAPAPHAHD

    >gi|84625118|ref|YP_452490.1| glutaredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MEIPVARYHVSDPIPTTEFPVSQDHTDQGAASGPQITLYSSAICPYCVAAKNFLKSKGKTWTEVRIDLDPAERDKMVALA
    KRTSVPQIFVGDVHVGGYDDMMAMHRAGKLEQLLAGSAGGQA

    >gi|84625322|ref|YP_452694.1| disulfide oxidoreductase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MKLLSRLPLLVLFLLPLLACAADKKAAPVEGEDYTLIDGGQPYAPLAGKVEVTEVFGYTCPHCAHFEPVLEAWVAKQPAY
    VRFTPVPAAFGGFWDAFARAYFAADILGLAKRSHRAMFDAIHEKQTVPTQNVAPEELAAFYASYGIPQQRFIETYKSEAV
    DAKLKAAREFALRSKIPGTPAIIVNGRYLIGARNYPDMLRIADYLIAREHAAPAKR

    >gi|84625323|ref|YP_452695.1| thiol:disulfide interchange protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MKTRFALTLMALLPILVACKAQDGSSDTAPAATTSAAGTAPAPAAAAPATDPAAPPAVGESATTPPPAAPSAAPRAPNGP
    EPVAGTDYLDIDGGQPYQQAAGKIEVAEVFGYV
    CPACNAFQPLIGPWKAGLPSDVHFVYVPAMFGNYWDDYGRAFYAAET
    LGVQEKTHEALYKAIHVDQTLKGEHGKDSVQDIAAFYAKYGVDQKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSLII
    NGKYLVKGQSFPEMLRIADHLIARERATLTK

    >gi|84625567|ref|YP_452939.1| disulphide-isomerase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MTLSLRRPSPSSLALLAVLSMLTACDKPAPPAAPSQTHAASTPAPATSIAWREGDVEDAFAEAKESGKPILLYWGAAWCP
    PCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGERFGVKAYPTIIVLRTDQSEITRLAGDADNARLAEVLRVAAK
    STSTAQQLLDKALHTPQQLSADDWAVLGNYAWGTDDRLVKPGDAAHVLTQLSTTAPQPALQRSFALAAISAAEHPPAASA
    ANRALLEAVLANPAEVRTNLSPLSYVPARLITAASNDAGVRTTLSNALNQALDKVYADTSLPISDRLGTAYARIQLARLA
    QGQPTEAETEGPQPPLPKDVVDTVHQRVTWATDTAKTDEERQSTISTAAALLSDVGDGSGAEQLLLAELPRSRTPYYYMP
    ELANLAEQRGDKKTALSWLKKAYDSAQGPATRVQWGVMYVNGLIRLSPDDTAGIESAATQVIGELAGQPDGYRQRTRQRF
    ASLGTTLKTWSKQHRQEGSAVLARLQQKMHSSCNSKNASECASWLS

    >gi|84625622|ref|YP_452994.1| hypothetical protein XOO_3965 [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MNFEELQAFVGRNPMLSLALVGLTIALIVTEIARLFRGYRALNPAELTRLINSENALVIDLSPTADFEKGHIAGSRNVAM
    AKFDPAGKLLANAKASPVVVV
    CRSGTTSAGAAKTLKKAGFEQVYWLEGGVAAWQMAELPLIKGR

    >gi|84625713|ref|YP_453085.1| thioredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRALAIKYHVRSIPMLL
    LFKNGEVQATQIGAVGKGQLTQMIDKTLGDAAA

    >gi|84625852|ref|YP_453224.1| organic hydroperoxide resistance protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MASPEKVLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGGDGTNPEQLFAAGYAACFIGAMKAVAAQDKITLPGE
    VSIDSSVGIGQIPGGFGIVVELRIAVPGMDKAELQALVDKAHQV
    CPYSNATRGNIDVTLTLA

    >gi|84625969|ref|YP_453341.1| glutathione peroxidase [Xanthomonas oryzae pv. oryzae MAFF 311018]
    MNQTLYDIPVTRIEGGPATLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRAQGLEVLAFPANDFNGQEPGSEAEIA
    QFCRLTYDVTFPMFAKIAVTGEQAHPLYQALTSTHPHTTGDGPMREKLAGYGIAPNPAPGVLWNFEKFLIGRDGKIIDRF
    APDIPADDARLLQAIDAALVV