Xanthomonas oryzae KACC10331 uid58155

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|58579663|ref|YP_198679.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MGFVREYATQAPERSAVDTRAGLQILEFGTDWCGHCMAAQPLLHTLLGGYEAIDYRKIEDGRGRPLGRSFRVTLWPTIIL
    LREGEELARA

    >gi|58580100|ref|YP_199116.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MQTLHATTPDDYAAALAAHPRLLVDYYKDNCPGCKMLDMSLTKFAASEDAAGVALLKVKLEVVGEEFFRDLGLRQTPTLA
    LFKDGAEVVRLPGFQSPAQVEAAVRSGL

    >gi|58580148|ref|YP_199164.1| iron-sulfur cluster insertion protein ErpA [Xanthomonas oryzae pv. oryzae KACC10331]
    MGTSGPHADGMSTLVSLPTAAPAPDYQSIDRPLHFSVAAAAKVRELIQEEGNADLALRVYIQGGGCSGFQYGFEFDENRA
    EDDLAVVTDGVTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV

    >gi|58580184|ref|YP_199200.1| C-type cytochrome biogenesis protein (copper tolerance) [Xanthomonas oryzae pv. oryzae KACC10331]
    MGPGRHPQGILTSMKSLSRWIARCALLAAPVFAASLVLSPAPAQAAVTEADLLPVDQAFVLSATADSRDRIALNWKIAPG
    YYLYRHRISVKSAQGFAAGELALPEGESKHDEFFGQVQTYRKQLRASLAGKADPAVQTAVLQVQYQGCADAGVCYPPQRR
    EIRVNLPAAEAAGTPGAAPQRENLGALVPRSAAGPRLFGTPGQTAGVDALPLPAEQAFNFEAIVGDGNSLLLRFTPAPGY
    YIYRDRTSLALEGTGGVRTGLPRWPQGKAHRDEHFGDVVVYFDQAEVTLPLLRDKPDPAHATLVATFQGCQTDGICYPPM
    TRRVTLDVPAGTVSPQNQAQAAPLMISPLAAGQVPVDPAPAAAPASAAGPVADASAGNPERTSPPHTDKGLLGMLVLALL
    GGLVLNLMPCVLPILSLKVLGLAHSGESRGHARSHAIWYSLGVLVSFAAIGGLVIGLRAAGQAAGWGFQLQQPWFVAALA
    YLMFAVGLSLSGVFTLGTNLGGIGQSLATRNGPLGDFFTGVLACVVASPCIAPFMGTALAYAFTAPALLAMLVFLALGLG
    LALPFLLIGFVPSLARRLPTPGAWMETLKQVLAFPMYLTAIWLLWVLGKQRGVDALALMLVGATLLALGLWCFERSRWKS
    HRLGMGLATVMLVLALVPVVAVTRLSLPAATAAEGGVAFSPQLLDRMRADNRVVFVNMTADW
    CVTCKANEKNVLSSAEFR
    DALRRVDAVYMKGDWTNVDPAISTFLDQHQAVGVPLYVVYGPGAPPAILPTVLTGAITEDALLRAAR

    >gi|58580313|ref|YP_199329.1| methionine sulfoxide reductase B [Xanthomonas oryzae pv. oryzae KACC10331]
    MSQFDLTPPSPAQRDALIAGLSDEEQRVLLQHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSSAKFESGTGWPSFFAPY
    DPAHVREIRDTSYGMIRTEIVCARCDSHLGHVFPDGPPPTGERH
    CLNSVSLGFTENGQALPNPLHREGAEAQSA

    >gi|122879042|ref|YP_199361.6| dihydrolipoamide dehydrogenase [Xanthomonas oryzae pv. oryzae KACC10331]
    MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVAKDQGLVTLESDKATLEVPSSAAGVVKELKVKVGDILSEGALVLLLETEG
    EAAAPAKAETKAAPAAVAPAAAPGSKPPVTPSHRAPAEPAPSKPALASDKPADIACKMVVLGAGPGGYTAAFRAADLGLD
    TVLIERYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVDFGQPKITLGTLREYKEKVVGKLTGGLASMAKQRKVR
    TVTGVATFVSPNELEIVGDDGKTQLLRFEHCIIAAGSQAVKLPNFPWDDKRVMDSTDALELHDIPKTLLVVGGGIIGLEM
    ATVYSALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGVDVHLKTKATDVTAGKKGITVSFEAAVEGDKPGLQATAYD
    RVLVAVGRSPNGKKIGADKAGVTVTERGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAGEKKEWVAR
    VIPSVAYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEETHRVIGGAIVGVHAGDLLAEI
    GLAIEMGAEAEDIGHTIHAHPTLSESVGMAAEVYDGTITDLYIPKKK

    >gi|58580463|ref|YP_199479.1| disulfide isomerase [Xanthomonas oryzae pv. oryzae KACC10331]
    MYRLAIAALLGAISLTACAQSSQPAASTVGAKPAAAPAAAGNVDQRVSTALKALDPDFKPDYLGAAPFPGFREVVVGGQV
    LYVSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTVPKADRIVFAPANPKYTVTVFTDVE
    CGYCRKLHSEIGELNK
    QGIAVEYLAFPRMGLGSQDHKEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQL
    GGYLPPAQLREALEKRAVATAGGSR

    >gi|58580531|ref|YP_199547.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MTIHVAERIPEIVLKRMRDGIEAVDTHTLFAGRTVLLFAVPGAFTPTCSAKHLPGYVEHFDALRKRGIEVRCTAVNDPFV
    MPAWGRNPLIPDGLHLLPDGNPELARAPDLEIDASGSGMGLRSRCYALYADDAVVEALFVEEPGEFKVSAADHVLQHLLD


    >gi|58580602|ref|YP_199618.1| disulfide bond formation protein B [Xanthomonas oryzae pv. oryzae KACC10331]
    MTMNPFRWSFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFAALAVFFLIGALHGPRAAGARKVYGVLSFI
    AAGVGMGIGARHVWVQIRPKDMMSS
    CGPPLSFLSETMGPFEVFRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWA
    LSAGFKARRSSLHH

    >gi|58580713|ref|YP_199729.1| glutaredoxin-like protein [Xanthomonas oryzae pv. oryzae KACC10331]
    MSLDPALRSRIDTLLQSSRVVLFMKGQPGMPQCGFSAKAVGVLDGLGIDYAHVNVLADQEIREGIKVYGDWPTIPQLYVD
    GELIGGSDIILQMADSGELSSMLGLQAPDRTPPKITITPAAVEMLKGALADAPDASLTLSIDANFQPNFQLAPTNPNAIA
    AESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPNAPKPVQELSVRDADDRLKAGSLTLVDVRPADERALASVAA
    PFRTLDAHERAAIEQLPKDTALAFL
    CHRGGRSLQAAEHFRSLGFTNVYNVTGGIDAWSDDVDNGVAKY

    >gi|58581051|ref|YP_200067.1| osmotically inducible protein [Xanthomonas oryzae pv. oryzae KACC10331]
    MGISRHATAHWEGDLKTGKGQLSTPQSGVMDNTRYAFSSRFGDEKGTNPEELIAAAHAGCFTMALSAQLTEAGFPPTSLD
    TRADVDLSMEGGPQLSQIRLKLKAVVPGIDEATFRELADTAKKN
    CPVSKALSAVPISLETEFSS

    >gi|58581072|ref|YP_200088.1| hypothetical protein XOO1449 [Xanthomonas oryzae pv. oryzae KACC10331]
    MLCAPGACTAITVSLVAARKQWPLTAVHVHLHDTQRGAAGMAITREIVLDGALDDEQRARLIEVADTWFFSRLRGARRTL
    RPVRMPTAPSAQ

    >gi|122879108|ref|YP_200160.6| glutathione S-transferase [Xanthomonas oryzae pv. oryzae KACC10331]
    MRPPLTVHGMSSSGNCYKVRLLLEQLVSRYHWVEVDSVAGQTRTPAYLAKNPNGKVPMVERDDGRVLTESNAILFWLAEG
    TPYLPTNAWQRAQALSWMFFEQYSHEPSVAMARFISLWTPRDAARRAELPQLRVRGEQALALMEQHLQQHAWFTGSDYGI
    ADIALFAYTHCAEDGRFDLERWPAITDWLQRVQALPRFVPMPSAASVTA

    >gi|58581161|ref|YP_200177.1| 6-O-methylguanine-DNA methyltransferase [Xanthomonas oryzae pv. oryzae KACC10331]
    MSTLHYDTFPSPIGALSVAADDTGVHHILFAQNRYDAIGRARWLHDPDAPLVRAAREQLLDYLHGGRGSFDLPLAPIGTP
    FQLSVWRTLAQIPFGQTWSYAQLAQAVGKPTANRAVGAANGRNPLPIVLP
    CHRVIGANGALTGFGGGLPTKQALLQLEGW
    SPRGGARADDLFAPASALRTG

    >gi|58581487|ref|YP_200503.1| polyketide synthase [Xanthomonas oryzae pv. oryzae KACC10331]
    MRKRFAIANPVSALRIPMPTNESPLLRIDIWSDVVCPWCWIGKRRFQSAIAALGAQAPVLDIHYHAFQLDPEAGLEPTPL
    RDALALKFGGTARVEQMLAQPQATAQAEGLPLDFDRGQVQVSTLRAHRLIWLASHEGDVDAVMEALFHAHFTEGHNVGAI
    ETLVHAGEAGGLAAARVQAMLESEEGIVEVHAQLAQAAALGIRAVPSFVINGRALIQGAQPPESVAQALLQLAAESTPVG
    GPDACGPDGCAV

    >gi|161898996|ref|YP_200681.2| dihydrolipoamide dehydrogenase [Xanthomonas oryzae pv. oryzae KACC10331]
    MAENYDVVVIGAGPAGYHAAIRAAQLGMKVACIDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHLFGDHGIS
    FNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIALKGTNVILAAGSESIELPF
    AKFDGDTIVDNVGGLDFTAVPKRLAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALTDAEVAKTALKEFKKQGLDIK
    LGAKVGKTEITGSGDAKQVLLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLAEGTGVKVTDRGQIEVDGHCHTGVDGVWA
    IGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAM
    GEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFNGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN

    >gi|58581687|ref|YP_200703.1| ABC transporter vitamin B12 uptake permease [Xanthomonas oryzae pv. oryzae KACC10331]
    MRWITGVVLNYNTDTQAVNCLSSPTDGTPSPVRRLNYRRALLMLLNRLLVIVFIGFFAKSAFAAGTPVLDVDYRPLAGKT
    PINLNLTYGGKVVMVVNTASK
    CGYTPQYEGLEALNQRFASRGFTLLGFPSNDFHGQEPGSEKQIQEFCTLTYGVKFPMFE
    KVHVLGAEATPLYQRLTQATGVAPGWNFHKYLIGRDGRVVAQFPSKIKPDDPSVLAAIERELKAPSR

    >gi|58581772|ref|YP_200788.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MVESRSPRLPTAVLVGAIVLLLALAALLVYAVVRSGQDDRDALPSALIGKPAPEFALPLLHDPSIVVHARELRGAPYIIN
    VWGSW
    CPACREEHPVLSRFALTKRVRVIGYNWKDERNDALRWLEQLGNPYLLVVADQDGRTAIDFGIAAAPETFLIDGRG
    VVRWKYSGMLTQSIIDTQLIPALSKIERSPTAAPDLHAKQ

    >gi|58581916|ref|YP_200932.1| hypothetical protein XOO2293 [Xanthomonas oryzae pv. oryzae KACC10331]
    MNAQLTQELPEFPTWLNARPSTLQEHRGRALVLAFVNASSVWCAESLAELAHWQARSPGRLQLIVVQVPRFDSERVPQRA
    LKQLRGHGVSAPILLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDLDKALTALCEGQQPPSDADLYGVAERDP
    EPHLALRFPTGLAATEDLLYVADTGHHRVLECTHSGRVLRQFGHGNADLIDGGVGEAAFRRPQGLALERDQLYVADTGNH
    ALRRINLRSGQVDTLCGTGRSGEPVEGPLASASASALNYPQGLAIADNQVLIAMAGDNRIWSYHLGRAALTARAGTGALE
    TRDGSGHLAAFAQPAGLASVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGTWQFGDQDGPRSTARVQFPQAIALAADS
    PLLWIADTGNGRLRCLRLGGGDLTTVELPRRLHGPAGLAVAAGAVWIAETDAHAILRYDLASGALSDVSIDE

    >gi|58581962|ref|YP_200978.1| glutathione peroxidase-like protein [Xanthomonas oryzae pv. oryzae KACC10331]
    MSDLSTFEFTDLEGRTQTMRDYAGKVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVIGFPCDQFGHQEPGDAAQIRQ
    FCSLDYAVDFPLAEKIEVNGSGAHPLWQWLKHEQRGVLGSEAIKWNFTKFLIGRDGRVLERYAPTTKPEALAADIERALD
    A

    >gi|58582040|ref|YP_201056.1| hypothetical protein XOO2417 [Xanthomonas oryzae pv. oryzae KACC10331]
    MSQARIAPIYGKRRCSAFCQVDAAWLYLSPLFWSALMTVSLTPAALERVQRFVQQTPGALGLRFGVTKTGCSGWGHITDL
    AREARDDDAVFEQGGVRIFVDPVSLPLVDGTCIDFGKHGLSETFTFSNPNATAECGCGESFTTADEHR

    >gi|58582070|ref|YP_201086.1| thiosulfate sulfurtransferase [Xanthomonas oryzae pv. oryzae KACC10331]
    MSADPNWSTLVDAATLAATLQHPQLRLLDARAAPPTAPDPDAAGKAYAQGHLPGAHYADLDHDLADLSRPAHGRHPLPHS
    AAFAKRLGEWGIDPHSQVVVYDAGDGSMAAARAWWMLRLMGHRRAAVLDGGLAAWRAAGFAQSTELPAVHDGAAYPGSFD
    TAAVVDAEQIVERLQQAPGWLLDARAGERFRGDVEPIDPVAGHVPGAVSRPLGLSLRDGRFKPVAELRAELSALLGAYQP
    DQVVVM
    CGSGVTACHLLLALEVAGLSGARVYAGSWSGWLQNASRPVATGS

    >gi|122879196|ref|YP_201153.6| molybdopterin biosynthesis protein MoeB [Xanthomonas oryzae pv. oryzae KACC10331]
    MSSHDISPADARARALQGALLIDIRQLHERASGQAEGALAIAQNALETEPATHLPEHAREIVLICQRGKRSAHTAAILRA
    HGYARVASVAGGTSAWASDGLPLVRPTLPPDEQDFLERYSRHLRLSQVGVEGQRRLARARVLLVGAGGLGSPAAFYLAAA
    GVGHLSIADDDVVDRSNLQRQILHTEDSVGTAKVDSAAQRIAALNPRVGIEAVQTRVTADNVEALLQDVDVVVDGADNFP
    ARYLLNDACVKRGKPLVYGAVQQFEGQVSVFDAGRNRGRAPCYRCLFPEPPPPEFAPS
    CAEAGVLGVLPGVIGLLQATEV
    IKLLLGIGDSLTGRLLSFDALAMRFRDIRLPPDPHCTVCAPGVVFGGYADYAAFCARAC

    >gi|58582170|ref|YP_201186.1| thioredoxin reductase [Xanthomonas oryzae pv. oryzae KACC10331]
    MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDPHGLMGPDLMTRMQAHAER
    FETEVIFDHIHTADLSQRPFRLTGDGAEYTCDALIIATGATAKYLGIPTEEAFKGRGVSA
    CATCDGFFYKDQDVVVVGGG
    NTAVEEALYLSNIARKVYLVHRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIDEVLGNDAGVTGVRVKSTIDGSTRDID
    AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDK
    SA

    >gi|58582341|ref|YP_201357.1| hypothetical protein XOO2718 [Xanthomonas oryzae pv. oryzae KACC10331]
    MCRTSPLGASQPSEDTVRKRHRMRRDPCQVHRRWPRLARMTQLHFDNRLRQQLPGYQEEGARRREVRAAWSAVMPTPVAA
    PYLIAHSAEMAHVLGLDASEVASAAFAQVFGGNALYPGMQPWAVNYGGHQFGHWAGQLGDGRAISLGEAIGIDGGRYELQ
    LKGAGPTPYSRGADGRAVLRSSIREFLCSESMHHLGVPTTRALSLVGTGDAVVRDMFYDGRPQREPGAIVCRVAPSFIRF
    GNFELPSARGDNALLRQWVDFTIARDFPELVGTAEALYADWFAQVCQRTAVMVAHWMRVGFVHGVMNTDNMSILGLTIDY
    GPYGWVDDYDPDWTPNTTDAQGRRYRFGTQPQVAYWNLGRLAQAMAPLFADQAPLQQGLNRFRDTYLACDRRDTAAKLGL
    AECRDEDLELIDALRALMRDAEMDMTLTFRGLIDLSPVHPDPAQLHDAFYDDHKRVASASQLQEWLQRYAARLQQDALSP
    DERRALMRLANPRYVLRNYLAQQAIDQAEQGDPSGVQELLEVMRRPYDDQSGRAAFAARRPEWARDRAG
    CSMLSCSS

    >gi|58582382|ref|YP_201398.1| stringent starvation protein A [Xanthomonas oryzae pv. oryzae KACC10331]
    MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVPVDPQNPPGDLIDLNPYHSVPTLVERDLVLYAASVVSEYLD
    ERYPHPPLMPIDPLSRARLRLAMLRIEHDWVPQVQAVQLGNKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCA
    MAPIIWRLDALEISLPKDGKAIEDYGNRIFRNPGFIRSLTDQEKKLRDLPG

    >gi|58582549|ref|YP_201565.1| bacterioferritin comigratory protein [Xanthomonas oryzae pv. oryzae KACC10331]
    MTDAMLELPAATFDLPLALSGGTQTTLRGHAGKWLVLYFYPKDSTPGCTTEGLDFNALLPQFKKAGAVVLGVSRDSVKSH
    DNFCAKQGFTFPLISDSDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPDGHVVQEWRKVKVAGHAEAVLAAVKAHAKQ


    >gi|58582554|ref|YP_201570.1| hypothetical protein XOO2931 [Xanthomonas oryzae pv. oryzae KACC10331]
    MQGLIEQYGLALVFANVLALSLGLPVPALPTLLLVGASYALQGGSDAWLAGLAALAVSVSASLLGDLAWYLAGRRFGNRT
    LQSLCRLSLSRDSCMKQTERFFSRWGVRVLAVAKFVPGLSLVSVPMAGAMRVRPAAFLRYDAFGASLWALVGLSVGAVFA
    HQVQDVLVFLSELGSGAVVVLAALLACYVGWRWRRYSLLRSLEHARIAVDELVPLLDGEEGLRPTVLDIRAPGYRDLQPY
    MIPGAVFADERQLAQILASVPRDRSVVIY
    CACPDEVSAACLAARMRARGYRDVRPLLGGLDAWRGAGHPVTSLLPVVVVA
    DASIAATA

    >gi|58582633|ref|YP_201649.1| C-type cytochrome biogenesis protein/thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MNRLLPLLGFLLLAALFGFGILWTMQHNPRDVPSPLIGKPAPAFSLPRLDQHEQRVSRDQLLGKPYVLNVFGSWCAECVH
    EHPVLMAQASRLGVPLIGYNYKDVPADATAWLARLGNPYAVVIADEAGQTAIDFGVYGAPETFLIDAQGVIRYKHIGVLT
    PDAIDDELLPAIAALPKGTP

    >gi|58582830|ref|YP_201846.1| hypothetical protein XOO3207 [Xanthomonas oryzae pv. oryzae KACC10331]
    MLVMERIQAEVEQHPIVLFMKGTPQFPMCEFSSRAVQALVAAGADQLRTINVLEEPEVRANLPRYSNWPTFPQLFIHGEL
    IGGCDITLELFEVGELKRIVSEAYQP

    >gi|58582955|ref|YP_201971.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MATTVPETAAPPPRRRIGARLVSAAFATITSHCCRTHFWKPMSDKPHVFDATTDTFETEVLHKSLTTPVLVDFWAAWCGP
    CKSLTPILEKLAGEYNGAFELGKVDVDKEQQIAAAFQIRSVPTVFLVKGGEIVDGFPGAMPEGQVREFLTQHGVLPAEPQ
    VAEEVPLAPLDPQAQAAALREAIAAQPDKDELKLDLALALLKTGDTAEAEQLIDALPANLATDDRAVRAKARLSFANVLK
    DAPDAGTLQATVDANGADLRARHLLGVRHLLDGNDEAALEQFLEMLRQDRTFDDNRPRRSLIDAFRVIEDEDLVGRYRRK
    MSALVF

    >gi|58583237|ref|YP_202253.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MTVRLVRGACALLLPLVLLAACKPASEGTPAAGSGTAPAATTQAPATPADPAAPPNSSVVQQTAEMPKLSLPTVTGETYD
    LAAHRGKWVVVNFWATW
    CAPCLKEMPELSALHTMRDTIEVVGLAYEDITSADMQAFLKDHPVSYPVAILDPYQPPQDFAT
    PRGLPMTYLIGPDGKVAKQFLGPVTARDIEAAVGITGKAG

    >gi|58583268|ref|YP_202284.1| alkyl hydroperoxide reductase subunit C [Xanthomonas oryzae pv. oryzae KACC10331]
    MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAAFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAKFPLIGDPAHKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLRKLTAAQFVAN
    NPGQVCPAKWKEGAKTLAPSLDLVGKI

    >gi|58583269|ref|YP_202285.1| alkyl hydroperoxide reductase subunit F [Xanthomonas oryzae pv. oryzae KACC10331]
    MRSDATPRPPLSHSQESSMLDANLKTQLTAYLERVTRPIQINASIDESPGSREMLDLLEELVLLSDKISLDIHRDDDQRK
    PSFALTTPGQDIALRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGDYRFETYFSLS
    CQNCPDVVQALNLA
    AVLNPRIKHVAIDGAWFQDEVETRQIMSVPTVYLNGELFDQGRMTLEQIVAKLDTNASKRDAAKIAAKGAFDVLVVGGGP
    AGAAAAVYAARKGIRTGVAAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYEVDIMNLQRAEQLIPAGADGLI
    EIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTL
    VEFDDKLRADDVLQRKLRSLHNVRIITSAQTTEVLGDGQKVTGLVYKDRTGGAIQHFDLEGVFVQIGLLPNTEFLRGTVA
    LSPRGEIIVDDRGQTDVPGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPATADNVAQAA

    >gi|58583280|ref|YP_202296.1| methionine sulfoxide reductase A [Xanthomonas oryzae pv. oryzae KACC10331]
    MRSCTMLGIGAFKQRIPRPGEALPGREQALPLHNTHLINGHPLRGEFTGLAQVQFGLGCFWGAERKFWKVPGVYTTAAGY
    AGGQTPNATYSEVCSGQTGHTEAVLVVFDEQAVSFEHLLRTFWESHDPTQGMQQGNDVGTQYRSAIYCTTQAQYAAALAS
    RDAYQQQLTAAGYGAITTEIGFPAPTFYYAEDDHQQYLAKHPNGYCGLGGTGVSCPIGLDA

    >gi|58583286|ref|YP_202302.1| hypothetical protein XOO3663 [Xanthomonas oryzae pv. oryzae KACC10331]
    MSGSDEGSADRLREFTEFRQRMNQRILAEPNQVVRRFFALDTQTYQAGTLDVKTKELLGLVASMVLRCDDCISYHVAQCK
    EAGVSREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLESGAQAPAPHAHD

    >gi|58583287|ref|YP_202303.1| glutaredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MEIPVARYHVSDPIPTTEFPVSQDHTDQGAASGPQITLYSSAICPYCVAAKNFLKSKGKTWTEVRIDLDPAERDKMVALA
    KRTSVPQIFVGDVHVGGYDDMMAMHRAGKLEQLLAGSAGGQA

    >gi|122879298|ref|YP_202523.6| thiol:disulfide interchange protein [Xanthomonas oryzae pv. oryzae KACC10331]
    MKTRFALTLMALLPILVACKAQDGSSDTAPAATTSAAGTAPAPAAAAPATDPAAPPAVGESATTPPPAAPSAAPRAPNGP
    EPVAGTDYLDIDGGQPYQQAAGKIEVAEVFGYV
    CPACNAFQPLIGPWKAGLPSDVHFVYVPAMFGNYWDDYGRAFYAAET
    LGVQEKTHEALYKAIHVDQTLKGEHGKDSVQDIAAFYAKYGVDQKTFIDTMSSFGVSAKTNRAKQFATRSKITGTPSLII
    NGKYLVKGQSFPEMLRIADHLIARERATLTK

    >gi|58583754|ref|YP_202770.1| disulphide-isomerase [Xanthomonas oryzae pv. oryzae KACC10331]
    MINLLPPVIAMTLSLRRPSPSSLALLAVLSMLTACDKPAPPAAPSQTHAASTPAPATSIAWREGDVEDAFAEAKESGKPI
    LLYWGAAW
    CPPCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGERFGVKAYPTIIVLRTDQSEITRLAGDADNAR
    LAEVLRVAAKSTSTAQQLLDKALHTPQQLSADDWAVLGNYAWGTDDRLVKPGDAAHVLTQLSTTAPQPALQRSFALAAIS
    AAEHPPAASAANRALLEAVLANPAEVRTNLSPLSYVPARLITAASNDAGVRTTLSNALNQALDKVYADTSLPISDRLGTA
    YARIQLARLAQGQPTEAETEGPQPPLPKDVVDTVHQRVTWATDTAKTDEERQSTISTAAALLSDVGDGSGAEQLLLAELP
    RSRTPYYYMPELANLAEQRGDKKTALSWLKKAYDSAQGPATRVQWGVMYVNGLIRLSPDDTAGIESAATQVIGELAGQPD
    GYRQRTRQRFASLGTTLKTWSKQHRQEGSAVLARLQQKMHSSCNSKNASECASWLS

    >gi|58583819|ref|YP_202835.1| hypothetical protein XOO4196 [Xanthomonas oryzae pv. oryzae KACC10331]
    MNFEELQAFVGRNPMLSLALVGLTIALIVTEIARLFRGYRALNPAELTRLINSENALVIDLSPTADFEKGHIAGSRNVAM
    AKFDPAGKLLANAKASPVVVV
    CRSGTTSAGAAKTLKKAGFEQVYWLEGGVAAWQMAELPLIKGR

    >gi|58583925|ref|YP_202941.1| thioredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
    MSDKVQHVGDADFDTAVLQSGEPVLVDFWAEWCGPCKMIAPVLDDLADTYQGRLKVAKVNVDQNRALAIKYHVRSIPMLL
    LFKNGEVQATQIGAVGKGQLTQMIDKTLGDAAA

    >gi|58584079|ref|YP_203095.1| organic hydroperoxide resistance protein [Xanthomonas oryzae pv. oryzae KACC10331]
    MSSPTRPQVCNTSSTRQSFTIQPLTRAQRSPWRTTMASPEKVLYTAHATATGGREGRAVSSDKALDAKLSTPRELGGAGG
    DGTNPEQLFAAGYAACFIGAMKAVAAQDKITLPGEVSIDSSVGIGQIPGGFGIVVELRIAVPGMDKAELQALVDKAHQV
    C
    PYSNATRGNIDVTLTLA

    >gi|58584198|ref|YP_203214.1| glutathione peroxidase [Xanthomonas oryzae pv. oryzae KACC10331]
    MNQTLYDIPVTRIEGGPATLADYRGKVLLVVNVASKCGLTPQYEGLEALYRDKRAQGLEVLAFPANDFNGQEPGSEAEIA
    QFCRLTYDVTFPMFAKIAVTGEQAHPLYQALTSTHPHTTGDGPMREKLAGYGIAPNPRARRVVELRKIPDRPRRQDHRPL
    RPGYPRRRCTPASGNRHGVGGLNLAILLGVSSACIAGEIALRCLS